Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fractalkine (CX3CL1) , partial

Product Specifications

CAS Number

9000-83-3

Gene Name

CX3CL1

UniProt

P78423

Expression Region

25-100aa

Organism

Homo sapiens

Target Sequence

QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Field of Research

Cell Adhesion

Assay Type

Developed Protein

Relevance

The soluble form is chotactic for T-cells and monocytes, but not for neutrophils. The mbrane-bound form promotes adhesion of those leukocytes to endothelial cells. May play a role in regulating leukocyte adhesion and migration processes at the endothelium. Binds to CX3CR1.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Length

Partial

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Acts as a ligand for both CX3CR1 and integrins. Binds to CX3CR1

Molecular Weight

24.6 kDa

References & Citations

Structural basis of chemokine sequestration by CrmD, a poxvirus-encoded tumor necrosis factor receptor.Xue X., Lu Q., Wei H., Wang D., Chen D., He G., Huang L., Wang H., Wang X.PLoS Pathog. 7:E1002162-E1002162 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fntb Mouse shRNA Lentiviral Particle (Locus ID 110606)
TL505936V 500 µL Each

Fntb Mouse shRNA Lentiviral Particle (Locus ID 110606)

Sign In for Pricing
View Details
Human NUDT9 Antibody (Biotin Conjugate)
32651-05121 150 µg

Human NUDT9 Antibody (Biotin Conjugate)

Sign In for Pricing
View Details
Igfbp1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6775208 1.0 µg DNA

Igfbp1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Guinea pig ADAMTS-like protein 2 (ADAMTSL2) ELISA Kit
MBS7207460-01 48 Well

Guinea pig ADAMTS-like protein 2 (ADAMTSL2) ELISA Kit

Sign In for Pricing
View Details
Guinea pig ADAMTS-like protein 2 (ADAMTSL2) ELISA Kit
MBS7207460-02 96 Well

Guinea pig ADAMTS-like protein 2 (ADAMTSL2) ELISA Kit

Sign In for Pricing
View Details
Guinea pig ADAMTS-like protein 2 (ADAMTSL2) ELISA Kit
MBS7207460-03 5x 96 Well

Guinea pig ADAMTS-like protein 2 (ADAMTSL2) ELISA Kit

Sign In for Pricing
View Details