Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROM1, Human (His)

ROM1 protein is involved in rod outer segment (ROS) morphogenesis, and may work with PRPH2 to maintain the structure of the curved intervertebral disc and organize ROS, thus affecting the intervertebral disc diameter. In addition, ROM1 is involved in protecting the retinal outer nuclear layer. ROM1 Protein, Human (His) is the recombinant human-derived ROM1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

ROM1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rom1-protein-human-his.html

Purity

96.0

Smiles

PGSLDEALEEGLVTALAHYKDTEVPGHCQAKRLVDELQLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSNVEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQD

Molecular Formula

6094 (Gene_ID) Q03395 (P126-D263) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CDCA7L Human siRNA Oligo Duplex (Locus ID 55536)
SR310754 1 Kit

CDCA7L Human siRNA Oligo Duplex (Locus ID 55536)

Ask
View Details
Anti-GABRA1 antibody
STJ13100147 100 µl

Anti-GABRA1 antibody

Ask
View Details
Recombinant Saccharomyces cerevisiae Uncharacterized plasma membrane protein YNL194C (YNL194C), partial
MBS7060920 Inquire

Recombinant Saccharomyces cerevisiae Uncharacterized plasma membrane protein YNL194C (YNL194C), partial

Ask
View Details
Rat Elastin Microfibril Interface Located Protein 1 ELISA Kit
MBS731085-01 48 Well

Rat Elastin Microfibril Interface Located Protein 1 ELISA Kit

Ask
View Details
Rat Elastin Microfibril Interface Located Protein 1 ELISA Kit
MBS731085-02 96 Well

Rat Elastin Microfibril Interface Located Protein 1 ELISA Kit

Ask
View Details
Rat Elastin Microfibril Interface Located Protein 1 ELISA Kit
MBS731085-03 5x 96 Well

Rat Elastin Microfibril Interface Located Protein 1 ELISA Kit

Ask
View Details