ROM1, Human (His)
ROM1 protein is involved in rod outer segment (ROS) morphogenesis, and may work with PRPH2 to maintain the structure of the curved intervertebral disc and organize ROS, thus affecting the intervertebral disc diameter. In addition, ROM1 is involved in protecting the retinal outer nuclear layer. ROM1 Protein, Human (His) is the recombinant human-derived ROM1 protein, expressed by E. coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
ROM1 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/rom1-protein-human-his.html
Purity
96.0
Smiles
PGSLDEALEEGLVTALAHYKDTEVPGHCQAKRLVDELQLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSNVEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQD
Molecular Formula
6094 (Gene_ID) Q03395 (P126-D263) (Accession)
Molecular Weight
Approximately 18 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
APC-Linked Polyclonal Antibody to Solute Carrier Family 39, Member 7 (SLC39A7)
APC-Linked Polyclonal Antibody to Solute Carrier Family 39, Member 7 (SLC39A7)
APC-Linked Polyclonal Antibody to Solute Carrier Family 39, Member 7 (SLC39A7)