Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROM1, Human (His)

ROM1 protein is involved in rod outer segment (ROS) morphogenesis, and may work with PRPH2 to maintain the structure of the curved intervertebral disc and organize ROS, thus affecting the intervertebral disc diameter. In addition, ROM1 is involved in protecting the retinal outer nuclear layer. ROM1 Protein, Human (His) is the recombinant human-derived ROM1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

ROM1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rom1-protein-human-his.html

Purity

96.0

Smiles

PGSLDEALEEGLVTALAHYKDTEVPGHCQAKRLVDELQLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSNVEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQD

Molecular Formula

6094 (Gene_ID) Q03395 (P126-D263) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), CF568 conjugate, 0.1mg/mL
BNC680305-100 1x 100 µL

CD95 (B-R18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL
BNC550146-500 1x 500 µL

CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF594 conjugate, 0.1mg/mL
BNC940630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL
BNC470460-100 1x 100 µL

CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL
BNC041037-500 1x 500 µL

CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL
BNC051429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details