Collagen Alpha-1 (XVIII) Chain/Endostatin, Human (P.pastoris)
Selected Variant
HY-P7009-01
Size: 10 µg
Endostatin Protein, Human (P.pastoris) is an endogenous antiangiogenic peptide with multiple antitumor roles through modulation of various receptors in the plasma membrane, such as suppression of angiogenesis and inhibition of tumor-cell migration and invasion.
Product Specifications
Product Name Alternative
Collagen Alpha-1 (XVIII) Chain/Endostatin Protein, Human (P.pastoris), Human, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/endostatin-protein-human-p-pastoris.html
Purity
97.00
Smiles
AHSHRDFQPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK
Molecular Formula
80781 (Gene_ID) P39060-3 (A1571-K1754) (Accession)
Molecular Weight
Approximately 16 kDa
References & Citations
[1]Guo ZY, et al. Effect of recombinant human endostatin on the expression of c-Myc and bFGF in mouse gastric cancer cells. Genet Mol Res. 2015 May 18;14 (2) :5258-65.|[2]Ren Z, et al. Anti-tumor effect of a novel soluble recombinant human endostatin: administered as a single agent or in combination with chemotherapy agents in mouse tumor models. PLoS One. 2014 Sep 17;9 (9) :e107823.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040812-100 1x 100 µL
Tyrosinase (OCA1/812), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040155-500 1x 500 µL
CD19 (CVID3/155), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680631-100 1x 100 µL
Human Lambda Light Chain (LcN-2), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC043793-500 1x 500 µL
Erythropoietin (EPO) (Marker of Placentation Disorders) (EPO/3793R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNUM1881-50 1x 50 µL
Prohibitin (Mitochondrial Marker) (PHB/1881), 1mg/mL
Sign In for Pricing
View Details 
BNC040009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details