Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free Noggin, Human (His)

Noggin is an antagonist of bone morphogenetic proteins (BMPs) and a member of the TGF-β superfamily, existing as a homodimer. Noggin binds to BMP-2/-4/-7 and inhibits their binding to BMPR-I/II receptors, thereby synergistically inducing bone differentiation in HMSCs, maintaining pluripotency in hESCs, inhibiting angiogenesis in HUVECs, and promoting myelination in oligodendrocytes, exerting neural activity[1][2][3][4]. Animal-Free Noggin Protein, Human (His) is an animal-free, recombinant human Noggin protein expressed in E. coli with a C-His tag. This product is recommended for use in cell culture.

Product Specifications

Product Name Alternative

Animal-Free Noggin Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-noggin-protein-human-his.html

Purity

98.0

Smiles

MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Molecular Formula

9241 (Gene_ID) Q13253 (Q28-C232) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Rifas L. The role of noggin in human mesenchymal stem cell differentiation. J Cell Biochem. 2007 Mar 1;100 (4) :824-34.|[2]Chaturvedi G, et al. Noggin maintains pluripotency of human embryonic stem cells grown on Matrigel. Cell Prolif. 2009 Aug;42 (4) :425-33.|[3]Kang HW, et al. In vitro and In vivo imaging of antivasculogenesis induced by Noggin protein expression in human venous endothelial cells. FASEB J. 2009 Dec;23 (12) :4126-34.|[4]Izrael M, et al. Human oligodendrocytes derived from embryonic stem cells: Effect of noggin on phenotypic differentiation in vitro and on myelination in vivo. Mol Cell Neurosci. 2007 Mar;34 (3) :310-23.|[5]Groppe J, et al. Structural basis of BMP signalling inhibition by the cystine knot protein Noggin. Nature. 2002 Dec 12;420 (6916) :636-42.|[6]Brunet LJ, et al. Noggin, cartilage morphogenesis, and joint formation in the mammalian skeleton. Science. 1998 May 29;280 (5368) :1455-7.|[7]Miriyala S, et al. Bone morphogenic protein-4 induces hypertension in mice: role of noggin, vascular NADPH oxidases, and impaired vasorelaxation. Circulation. 2006 Jun 20;113 (24) :2818-25.Miriyala S, et al. Bone morphogenic protein-4 induces hypertension in mice: role of noggin, vascular NADPH oxidases, and impaired vasorelaxation. Circulation. 2006 Jun 20;113 (24) :2818-25.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UPK3A Recombinant Protein (Rat)
RP235940 100 µg

UPK3A Recombinant Protein (Rat)

Sign In for Pricing
View Details
FITC-Goat Anti-Rabbit IgG F (ab') 2
E-AB-1111-01 120 μL

FITC-Goat Anti-Rabbit IgG F (ab') 2

Sign In for Pricing
View Details
FITC-Goat Anti-Rabbit IgG F (ab') 2
E-AB-1111-02 500 µL

FITC-Goat Anti-Rabbit IgG F (ab') 2

Sign In for Pricing
View Details
FITC-Goat Anti-Rabbit IgG F (ab') 2
E-AB-1111-03 1 mL

FITC-Goat Anti-Rabbit IgG F (ab') 2

Sign In for Pricing
View Details
Rat Vascular Endothelial cell Growth Factor C (VEGF-C) Elisa Kit
EK720909 96 Well

Rat Vascular Endothelial cell Growth Factor C (VEGF-C) Elisa Kit

Sign In for Pricing
View Details
EIDD-1931 50mg
A16510-50 50 mg

EIDD-1931 50mg

Sign In for Pricing
View Details