Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free Noggin, Human (His)

Noggin is an antagonist of bone morphogenetic proteins (BMPs) and a member of the TGF-β superfamily, existing as a homodimer. Noggin binds to BMP-2/-4/-7 and inhibits their binding to BMPR-I/II receptors, thereby synergistically inducing bone differentiation in HMSCs, maintaining pluripotency in hESCs, inhibiting angiogenesis in HUVECs, and promoting myelination in oligodendrocytes, exerting neural activity[1][2][3][4]. Animal-Free Noggin Protein, Human (His) is an animal-free, recombinant human Noggin protein expressed in E. coli with a C-His tag. This product is recommended for use in cell culture.

Product Specifications

Product Name Alternative

Animal-Free Noggin Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-noggin-protein-human-his.html

Purity

98.0

Smiles

MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Molecular Formula

9241 (Gene_ID) Q13253 (Q28-C232) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Rifas L. The role of noggin in human mesenchymal stem cell differentiation. J Cell Biochem. 2007 Mar 1;100 (4) :824-34.|[2]Chaturvedi G, et al. Noggin maintains pluripotency of human embryonic stem cells grown on Matrigel. Cell Prolif. 2009 Aug;42 (4) :425-33.|[3]Kang HW, et al. In vitro and In vivo imaging of antivasculogenesis induced by Noggin protein expression in human venous endothelial cells. FASEB J. 2009 Dec;23 (12) :4126-34.|[4]Izrael M, et al. Human oligodendrocytes derived from embryonic stem cells: Effect of noggin on phenotypic differentiation in vitro and on myelination in vivo. Mol Cell Neurosci. 2007 Mar;34 (3) :310-23.|[5]Groppe J, et al. Structural basis of BMP signalling inhibition by the cystine knot protein Noggin. Nature. 2002 Dec 12;420 (6916) :636-42.|[6]Brunet LJ, et al. Noggin, cartilage morphogenesis, and joint formation in the mammalian skeleton. Science. 1998 May 29;280 (5368) :1455-7.|[7]Miriyala S, et al. Bone morphogenic protein-4 induces hypertension in mice: role of noggin, vascular NADPH oxidases, and impaired vasorelaxation. Circulation. 2006 Jun 20;113 (24) :2818-25.Miriyala S, et al. Bone morphogenic protein-4 induces hypertension in mice: role of noggin, vascular NADPH oxidases, and impaired vasorelaxation. Circulation. 2006 Jun 20;113 (24) :2818-25.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit
RDR-VEGFR2-Mu-96Tests 96 Tests

Mouse Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit

Sign In for Pricing
View Details
Mouse Zfp703 Pre-designed siRNA Set B
SI116514B 1 Each

Mouse Zfp703 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Magic™ Membrane Protein Human TMEM45A (Transmembrane protein 45A) Expressed in vitro E.coli expression system, Full Length
MPX2363K Each

Magic™ Membrane Protein Human TMEM45A (Transmembrane protein 45A) Expressed in vitro E.coli expression system, Full Length

Sign In for Pricing
View Details
CAMK2D (Calcium/Calmodulin-Dependent Protein Kinase II delta, CAMKD, DKFZp686G23119, DKFZp686I2288, MGC44911) (AP) discontinued
244190-AP 100 µL

CAMK2D (Calcium/Calmodulin-Dependent Protein Kinase II delta, CAMKD, DKFZp686G23119, DKFZp686I2288, MGC44911) (AP) discontinued

Sign In for Pricing
View Details
FDPS Protein Vector (Mouse) (pPM-C-HA)
20418025 500 ng

FDPS Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Mouse Chymotrypsin-like elastase family member 2A Protein, His, E.coli-100ug
QP5817-ec-100ug 100ug

Recombinant Mouse Chymotrypsin-like elastase family member 2A Protein, His, E.coli-100ug

Sign In for Pricing
View Details