Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEDD8, Human

NEDD8 is an important ubiquitin-like protein that plays a key role in cell cycle regulation and embryogenesis by binding to specific proteins such as cullin and p53/TP53. Its binding to cullin is critical for recruiting E2 enzymes to the cullin-RING-based E3 ubiquitin-protein ligase complex, thereby enabling degradation of regulatory proteins. NEDD8 Protein, Human is the recombinant human-derived NEDD8 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

NEDD8 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nedd8-protein-human.html

Purity

98.0

Smiles

MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG

Molecular Formula

4738 (Gene_ID) Q15843 (M1-G76) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Low Density LRP Antibody (1F6C6)
NBP2-52507 0.1 mg

Mouse Monoclonal Low Density LRP Antibody (1F6C6)

Sign In for Pricing
View Details
KNDC1 Rabbit Polyclonal Antibody (RBITC)
orb1057392 100 µL

KNDC1 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Dnm2 Mouse shRNA Plasmid (Locus ID 13430)
TR513405 1 Kit

Dnm2 Mouse shRNA Plasmid (Locus ID 13430)

Sign In for Pricing
View Details
Recombinant Human G-protein coupled receptor 6 (GPR6), partial
MBS7111748-01 0.05 mg (E-Coli)

Recombinant Human G-protein coupled receptor 6 (GPR6), partial

Sign In for Pricing
View Details
Recombinant Human G-protein coupled receptor 6 (GPR6), partial
MBS7111748-02 0.2 mg (E-Coli)

Recombinant Human G-protein coupled receptor 6 (GPR6), partial

Sign In for Pricing
View Details
Recombinant Human G-protein coupled receptor 6 (GPR6), partial
MBS7111748-03 0.05 mg (Yeast)

Recombinant Human G-protein coupled receptor 6 (GPR6), partial

Sign In for Pricing
View Details