Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Enoyl-ACP Reductase, E. coli (His)

Enoyl-ACP Reductase Protein is a member of the Short chain Dehydrogenase Reductase (SDR) superfamily.It is a key enzyme of the type II fatty acid synthesis (FAS) system.Enoyl-ACP Reductase catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP) .And it is involved in the elongation cycle of fatty acid which are used in the lipid metabolism and in the biotin biosynthesis.Enoyl-ACP Reductase Protein, E.coli (His) is the recombinant E.coli-derived Enoyl-ACP Reductase protein, expressed by E.coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Enoyl-ACP Reductase Protein, E. coli (His), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/enoyl-acp-reductase-protein-e-coli-his.html

Purity

95.20

Smiles

GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK

Molecular Formula

/ (Gene_ID) WP_000506490 (G2-K262) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TARS2 3'UTR GFP Stable Cell Line
TU075135 1.0 mL

TARS2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Kdm4c sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6213607 1.0 µg DNA

Kdm4c sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
MORN4 ORF Vector (Human) (pORF)
ORF006579 1.0 µg DNA

MORN4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
RMP (Unconventional Prefoldin RPB5 Interactor, RNA Polymerase II Subunit 5-mediating Protein, Protein NNX3, RPB5-mediating Protein, C19orf2, NNX3, URI)
R2039-21N 100 µL

RMP (Unconventional Prefoldin RPB5 Interactor, RNA Polymerase II Subunit 5-mediating Protein, Protein NNX3, RPB5-mediating Protein, C19orf2, NNX3, URI)

Sign In for Pricing
View Details
ZBTB26 (NM_020924) Human Recombinant Protein
TP761529 50 µg

ZBTB26 (NM_020924) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Apolipoprotein B100 (APOB100)
MBS2153849-01 0.01 mg

Recombinant Apolipoprotein B100 (APOB100)

Sign In for Pricing
View Details