Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Enoyl-ACP Reductase, E. coli (His)

Enoyl-ACP Reductase Protein is a member of the Short chain Dehydrogenase Reductase (SDR) superfamily.It is a key enzyme of the type II fatty acid synthesis (FAS) system.Enoyl-ACP Reductase catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP) .And it is involved in the elongation cycle of fatty acid which are used in the lipid metabolism and in the biotin biosynthesis.Enoyl-ACP Reductase Protein, E.coli (His) is the recombinant E.coli-derived Enoyl-ACP Reductase protein, expressed by E.coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Enoyl-ACP Reductase Protein, E. coli (His), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/enoyl-acp-reductase-protein-e-coli-his.html

Purity

95.20

Smiles

GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK

Molecular Formula

/ (Gene_ID) WP_000506490 (G2-K262) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCNDBP1 Antibody
GWB-MT834F 50 µg

CCNDBP1 Antibody

Sign In for Pricing
View Details
ZIC3 (Zinc Finger Protein of the Cerebellum 3, Zinc Finger Protein ZIC 3, Zinc Finger Protein 203, ZNF203) (Biotin)
135570-Biotin 100 µL

ZIC3 (Zinc Finger Protein of the Cerebellum 3, Zinc Finger Protein ZIC 3, Zinc Finger Protein 203, ZNF203) (Biotin)

Sign In for Pricing
View Details
Mouse Chst7 Pre-designed siRNA Set B
SI102586B 1 Each

Mouse Chst7 Pre-designed siRNA Set B

Sign In for Pricing
View Details
COL7A1 Protein Vector (Rat) (pPM-C-His)
PV261109 500 ng

COL7A1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
CSF1R (3V2) Mouse Monoclonal Antibody
E28PB4109 100 µL

CSF1R (3V2) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CSN2 3'UTR Luciferase Stable Cell Line
TU005111 1.0 mL

CSN2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details