Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Enoyl-ACP Reductase, E. coli (His)

Enoyl-ACP Reductase Protein is a member of the Short chain Dehydrogenase Reductase (SDR) superfamily.It is a key enzyme of the type II fatty acid synthesis (FAS) system.Enoyl-ACP Reductase catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP) .And it is involved in the elongation cycle of fatty acid which are used in the lipid metabolism and in the biotin biosynthesis.Enoyl-ACP Reductase Protein, E.coli (His) is the recombinant E.coli-derived Enoyl-ACP Reductase protein, expressed by E.coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Enoyl-ACP Reductase Protein, E. coli (His), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/enoyl-acp-reductase-protein-e-coli-his.html

Purity

95.20

Smiles

GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK

Molecular Formula

/ (Gene_ID) WP_000506490 (G2-K262) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC27A4 Protein Vector (Mouse) (pPB-N-His)
PV230371 500 ng

SLC27A4 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Human fetal sulfoslycoprotein antigen ELISA Kit
ELA-E1385h 96 Tests

Human fetal sulfoslycoprotein antigen ELISA Kit

Sign In for Pricing
View Details
Anti-Human SLC6A8 Polyclonal Antibody
HC814014-01 50 µg

Anti-Human SLC6A8 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human SLC6A8 Polyclonal Antibody
HC814014-02 100 µg

Anti-Human SLC6A8 Polyclonal Antibody

Sign In for Pricing
View Details
EGFR Blocking Peptide
abx062566-01 1 mg

EGFR Blocking Peptide

Sign In for Pricing
View Details
EGFR Blocking Peptide
abx062566-02 5 mg

EGFR Blocking Peptide

Sign In for Pricing
View Details