Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Enoyl-ACP Reductase, E. coli (His)

Enoyl-ACP Reductase Protein is a member of the Short chain Dehydrogenase Reductase (SDR) superfamily.It is a key enzyme of the type II fatty acid synthesis (FAS) system.Enoyl-ACP Reductase catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP) .And it is involved in the elongation cycle of fatty acid which are used in the lipid metabolism and in the biotin biosynthesis.Enoyl-ACP Reductase Protein, E.coli (His) is the recombinant E.coli-derived Enoyl-ACP Reductase protein, expressed by E.coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Enoyl-ACP Reductase Protein, E. coli (His), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/enoyl-acp-reductase-protein-e-coli-his.html

Purity

95.20

Smiles

GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK

Molecular Formula

/ (Gene_ID) WP_000506490 (G2-K262) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ginisortamab Biosimilar - Research Grade
ICH5244-50mg 50 mg

Ginisortamab Biosimilar - Research Grade

Sign In for Pricing
View Details
2-bromo-1,1':3',1'':4'',1'''-quaterphenyl
JH919595 1 Each

2-bromo-1,1':3',1'':4'',1'''-quaterphenyl

Sign In for Pricing
View Details
COMP (NM_000095) Human Mass Spec Standard
PH311080 10 µg

COMP (NM_000095) Human Mass Spec Standard

Sign In for Pricing
View Details
CapTrack CR1 Benchtop Tube Recapper
CR1 1 Each

CapTrack CR1 Benchtop Tube Recapper

Sign In for Pricing
View Details
COPS3 (NM_003653) Human Tagged ORF Clone Lentiviral Particle
RC200486L3V 200 µL

COPS3 (NM_003653) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PKD2L1 Antibody
E38QA7325 100 µL

PKD2L1 Antibody

Sign In for Pricing
View Details