Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Enoyl-ACP Reductase, E. coli (His)

Enoyl-ACP Reductase Protein is a member of the Short chain Dehydrogenase Reductase (SDR) superfamily.It is a key enzyme of the type II fatty acid synthesis (FAS) system.Enoyl-ACP Reductase catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP) .And it is involved in the elongation cycle of fatty acid which are used in the lipid metabolism and in the biotin biosynthesis.Enoyl-ACP Reductase Protein, E.coli (His) is the recombinant E.coli-derived Enoyl-ACP Reductase protein, expressed by E.coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Enoyl-ACP Reductase Protein, E. coli (His), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/enoyl-acp-reductase-protein-e-coli-his.html

Purity

95.20

Smiles

GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK

Molecular Formula

/ (Gene_ID) WP_000506490 (G2-K262) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM17 Antibody (C-term)
E45G01551G-1 100 µL

ADAM17 Antibody (C-term)

Sign In for Pricing
View Details
RGH19 (ARHGAP19) (NM_032900) Human Tagged Lenti ORF Clone
RC222308L4 10 µg

RGH19 (ARHGAP19) (NM_032900) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ARHGAP9 (NM_032496) Human Tagged ORF Clone Lentiviral Particle
RC223605L4V 200 µL

ARHGAP9 (NM_032496) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Porcine E3 ubiquitin-protein ligase UHRF2 (UHRF2) ELISA Kit
EIA06878p 1 Kit

Porcine E3 ubiquitin-protein ligase UHRF2 (UHRF2) ELISA Kit

Sign In for Pricing
View Details
OriCell™ Complete Medium For PED Cell Line
CMP3-0101 500 mL

OriCell™ Complete Medium For PED Cell Line

Sign In for Pricing
View Details
SHP1 (PTPN6) (NM_002831) Human Over-expression Lysate
LY401007 100 µg

SHP1 (PTPN6) (NM_002831) Human Over-expression Lysate

Sign In for Pricing
View Details