Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Enoyl-ACP Reductase, E. coli (His)

Enoyl-ACP Reductase Protein is a member of the Short chain Dehydrogenase Reductase (SDR) superfamily.It is a key enzyme of the type II fatty acid synthesis (FAS) system.Enoyl-ACP Reductase catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP) .And it is involved in the elongation cycle of fatty acid which are used in the lipid metabolism and in the biotin biosynthesis.Enoyl-ACP Reductase Protein, E.coli (His) is the recombinant E.coli-derived Enoyl-ACP Reductase protein, expressed by E.coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Enoyl-ACP Reductase Protein, E. coli (His), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/enoyl-acp-reductase-protein-e-coli-his.html

Purity

95.20

Smiles

GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK

Molecular Formula

/ (Gene_ID) WP_000506490 (G2-K262) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC28A3 knockout cell line
ABC-KH14017 1 Vial

Human SLC28A3 knockout cell line

Sign In for Pricing
View Details
Rabbit Polyclonal BIN1 Antibody [PerCP]
NBP1-46170PCP 0.1 mL

Rabbit Polyclonal BIN1 Antibody [PerCP]

Sign In for Pricing
View Details
SMARCD1 Antibody
A35185-100UL 100 µL

SMARCD1 Antibody

Sign In for Pricing
View Details
Human Synaptotagmin-like protein 5, SYTL5 ELISA KIT
ELI-13687h 96 Tests

Human Synaptotagmin-like protein 5, SYTL5 ELISA KIT

Sign In for Pricing
View Details
hsa-miR-6796-5p miRNA Mimic
MCH03554 2x 2.5 nmol

hsa-miR-6796-5p miRNA Mimic

Sign In for Pricing
View Details
Rpl38 AAV siRNA Pooled Vector
41641164 1.0 µg

Rpl38 AAV siRNA Pooled Vector

Sign In for Pricing
View Details