Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Enoyl-ACP Reductase, E. coli (His)

Enoyl-ACP Reductase Protein is a member of the Short chain Dehydrogenase Reductase (SDR) superfamily.It is a key enzyme of the type II fatty acid synthesis (FAS) system.Enoyl-ACP Reductase catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP) .And it is involved in the elongation cycle of fatty acid which are used in the lipid metabolism and in the biotin biosynthesis.Enoyl-ACP Reductase Protein, E.coli (His) is the recombinant E.coli-derived Enoyl-ACP Reductase protein, expressed by E.coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Enoyl-ACP Reductase Protein, E. coli (His), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/enoyl-acp-reductase-protein-e-coli-his.html

Purity

95.20

Smiles

GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK

Molecular Formula

/ (Gene_ID) WP_000506490 (G2-K262) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thymol Blue
42040000-2 25 g

Thymol Blue

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Rabbit IgG Fc Secondary Antibody [Rhodamine] (Pre-absorbed)
NBP1-73329 2 mg

Goat Polyclonal Goat anti-Rabbit IgG Fc Secondary Antibody [Rhodamine] (Pre-absorbed)

Sign In for Pricing
View Details
Human DPY19L4 Knockout A549 cell line
GTR15414846 1 Vial

Human DPY19L4 Knockout A549 cell line

Sign In for Pricing
View Details
SCLY (NM_016510) Human Tagged Lenti ORF Clone
RC203164L4 10 µg

SCLY (NM_016510) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
C17orf12 sgRNA CRISPR Lentivector (Human) (Target 2)
K0315803 1.0 µg DNA

C17orf12 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Calreticulin (CALR) Mouse Monoclonal Antibody [Clone ID: LBI6H10]
AMM21101VCF 100 µg

Calreticulin (CALR) Mouse Monoclonal Antibody [Clone ID: LBI6H10]

Sign In for Pricing
View Details