Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Enoyl-ACP Reductase, E. coli (His)

Enoyl-ACP Reductase Protein is a member of the Short chain Dehydrogenase Reductase (SDR) superfamily.It is a key enzyme of the type II fatty acid synthesis (FAS) system.Enoyl-ACP Reductase catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP) .And it is involved in the elongation cycle of fatty acid which are used in the lipid metabolism and in the biotin biosynthesis.Enoyl-ACP Reductase Protein, E.coli (His) is the recombinant E.coli-derived Enoyl-ACP Reductase protein, expressed by E.coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Enoyl-ACP Reductase Protein, E. coli (His), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/enoyl-acp-reductase-protein-e-coli-his.html

Purity

95.20

Smiles

GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK

Molecular Formula

/ (Gene_ID) WP_000506490 (G2-K262) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ALAS2  (6C1)
YF-MA11883 100 ug

Anti-ALAS2 (6C1)

Sign In for Pricing
View Details
DEFB108P2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0579206 1.0 µg DNA

DEFB108P2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Guinea pig Cross Linked N-telopeptide of Type I Collagen (NTXI) ELISA Kit
abx357340 96 Well

Guinea pig Cross Linked N-telopeptide of Type I Collagen (NTXI) ELISA Kit

Sign In for Pricing
View Details
Histone H4, Recombinant, Xenopus laevis discontinued
H5110-15V 100 µg

Histone H4, Recombinant, Xenopus laevis discontinued

Sign In for Pricing
View Details
BDE 191 10ug/ml in Iso-octane
BDE19101ZT10 10 mL

BDE 191 10ug/ml in Iso-octane

Sign In for Pricing
View Details
Osteocalcin, Bovine (Bone-Gla-Protein, BGP)
O8060-11 100 µg

Osteocalcin, Bovine (Bone-Gla-Protein, BGP)

Sign In for Pricing
View Details