Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Enoyl-ACP Reductase, E. coli (His)

Enoyl-ACP Reductase Protein is a member of the Short chain Dehydrogenase Reductase (SDR) superfamily.It is a key enzyme of the type II fatty acid synthesis (FAS) system.Enoyl-ACP Reductase catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP) .And it is involved in the elongation cycle of fatty acid which are used in the lipid metabolism and in the biotin biosynthesis.Enoyl-ACP Reductase Protein, E.coli (His) is the recombinant E.coli-derived Enoyl-ACP Reductase protein, expressed by E.coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Enoyl-ACP Reductase Protein, E. coli (His), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/enoyl-acp-reductase-protein-e-coli-his.html

Purity

95.20

Smiles

GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK

Molecular Formula

/ (Gene_ID) WP_000506490 (G2-K262) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSL1521 Plasmid
PVT82540 2 µg

PSL1521 Plasmid

Sign In for Pricing
View Details
Slc16a13 ORF Vector (Mouse) (pORF)
ORF057441 1.0 µg DNA

Slc16a13 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rabbit Anti-FGF21 antibody
SL2318R-01 50 µL

Rabbit Anti-FGF21 antibody

Sign In for Pricing
View Details
Rabbit Anti-FGF21 antibody
SL2318R-02 100 µL

Rabbit Anti-FGF21 antibody

Sign In for Pricing
View Details
FBXO15 Antibody (Biotin)
abx309701-01 20 µg

FBXO15 Antibody (Biotin)

Sign In for Pricing
View Details
FBXO15 Antibody (Biotin)
abx309701-02 50 µg

FBXO15 Antibody (Biotin)

Sign In for Pricing
View Details