Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Enoyl-ACP Reductase, E. coli (His)

Enoyl-ACP Reductase Protein is a member of the Short chain Dehydrogenase Reductase (SDR) superfamily.It is a key enzyme of the type II fatty acid synthesis (FAS) system.Enoyl-ACP Reductase catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP) .And it is involved in the elongation cycle of fatty acid which are used in the lipid metabolism and in the biotin biosynthesis.Enoyl-ACP Reductase Protein, E.coli (His) is the recombinant E.coli-derived Enoyl-ACP Reductase protein, expressed by E.coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Enoyl-ACP Reductase Protein, E. coli (His), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/enoyl-acp-reductase-protein-e-coli-his.html

Purity

95.20

Smiles

GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK

Molecular Formula

/ (Gene_ID) WP_000506490 (G2-K262) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Nuclear Factor Kappa B (NFkB) ELISA Kit
EKL62333 96 Tests

Mouse Nuclear Factor Kappa B (NFkB) ELISA Kit

Sign In for Pricing
View Details
Human ATG4A knockdown cell line
ABC-KD1140 1 Vial

Human ATG4A knockdown cell line

Sign In for Pricing
View Details
Lentiviral human HEATR3 shRNA (UAS) - Lentiviral human HEATR3 shRNA (UAS, RFP) plasmid
GTR15123085 1 Vial

Lentiviral human HEATR3 shRNA (UAS) - Lentiviral human HEATR3 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Chromosome 14 Open Reading Frame 159 (C14orf159) Antibody
abx231022 100 µg

Chromosome 14 Open Reading Frame 159 (C14orf159) Antibody

Sign In for Pricing
View Details
Human CD85g/LILRA4/ILT7 Recombinant Protein (C-Fc)
HX894021-01 50 µg

Human CD85g/LILRA4/ILT7 Recombinant Protein (C-Fc)

Sign In for Pricing
View Details
Human CD85g/LILRA4/ILT7 Recombinant Protein (C-Fc)
HX894021-02 100 µg

Human CD85g/LILRA4/ILT7 Recombinant Protein (C-Fc)

Sign In for Pricing
View Details