Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b)

Product Specifications

Product Name Alternative

Ns4.8;4.8 kDa accessory protein

Abbreviation

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa

Gene Name

4b

UniProt

P0C2R2

Expression Region

1-45aa

Organism

Bovine coronavirus (strain 98TXSF-110-LUN) (BCoV-LUN) (BCV)

Target Sequence

MPMATTIEGADYTNIMPITVLTTVYLGVSIGIDTSTTGFTCFSRY

Tag

C-terminal 6xHis-tagged

Type

Developed Protein & Coronavirus Protein

Source

Yeast

Field of Research

Microbiology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

6.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL
BNC400225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL
BNC470034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL
BNC040965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF568 conjugate, 0.1mg/mL
BNC680164-500 1x 500 µL

CD28 (204.12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Smooth Muscle Myosin Heavy Chain (SM-MHC) (MYH11/2303R), CF640R conjugate, 0.1mg/mL
BNC402303-100 1x 100 µL

Smooth Muscle Myosin Heavy Chain (SM-MHC) (MYH11/2303R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (Leucocyte Marker) (PTPRC/1147 + PTPRC/1460), CF594 conjugate, 0.1mg/mL
BNC942027-100 1x 100 µL

CD45 / LCA (Leucocyte Marker) (PTPRC/1147 + PTPRC/1460), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details