Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-1 alpha protein (Il1a) (Active)

Product Specifications

Product Name Alternative

IL-1 alpha

Abbreviation

Recombinant Mouse Il1a protein (Active)

Gene Name

Il1a

UniProt

P01582

Expression Region

115-270aa

Organism

Mus musculus (Mouse)

Target Sequence

SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>97% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 2 pg/ml, corresponding to a specific activity of > 5.0 x 108 IU/mg.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Molecular Weight

17.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDRG1 Rabbit Monoclonal Antibody [Clone ID: 24GB4985]
TA425097 100 µL

NDRG1 Rabbit Monoclonal Antibody [Clone ID: 24GB4985]

Sign In for Pricing
View Details
ATP citrate lyase Recombinant Rabbit Monoclonal Antibody [ST51-07]
ET1609-37 100 µL

ATP citrate lyase Recombinant Rabbit Monoclonal Antibody [ST51-07]

Sign In for Pricing
View Details
PCBP2 (NM_001128913) Human Over-expression Lysate
LC427015 20 µg

PCBP2 (NM_001128913) Human Over-expression Lysate

Sign In for Pricing
View Details
C17orf49 Human Gene Knockout Kit (CRISPR)
KN423760 1 Kit

C17orf49 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Cebpzos activation kit by CRISPRa
GA207855 1 Kit

Mouse Cebpzos activation kit by CRISPRa

Sign In for Pricing
View Details
Alpha-Aleuritic Acid
TRC-A525500-1G 1 g

Alpha-Aleuritic Acid

Sign In for Pricing
View Details