MIP-1 alpha/CCL3, Human
MIP-1 alpha/CCL3 Protein, Human, an important chemokine, is a key regulator of immune microenvironment and primarily mediates the trafficking of immune cells in both inflammation and cancer. MIP-1 alpha/CCL3 Protein, Human is a recombinant human CCL3 (S24-A92) expressed by E.coil[1].
Product Specifications
Product Name Alternative
MIP-1 alpha/CCL3 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mip-1-alpha-ccl3-protein-human.html
Purity
98.0
Smiles
SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Molecular Formula
6348 (Gene_ID) P10147 (S24-A92) (Accession)
Molecular Weight
Approximately 12 kDa
References & Citations
[1]Zhang G, et al. CCL3 participates in the development of rheumatoid arthritis by activating AKT. Eur Rev Med Pharmacol Sci. 2018 Oct;22 (20) :6625-6632.|[2]Zhang G, et al. CCL3 participates in the development of rheumatoid arthritis by activating AKT. Eur Rev Med Pharmacol Sci. 2018 Oct;22 (20) :6625-6632.|[3]Fabrizio Montecucco, et al. Tumor necrosis factor-alpha (TNF-alpha) induces integrin CD11b/CD18 (Mac-1) up-regulation and migration to the CC chemokine CCL3 (MIP-1alpha) on human neutrophils through defined signalling pathways. Cell Signal. 2008 Mar;20 (3) :557-68.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY427231 100 µg
Calumenin (CALU) (NM_001130674) Human Over-expression Lysate
Sign In for Pricing
View Details ![FGF21 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B9]](https://cdn.genprice.uk/products/937/68dd1b6a061270361ea1611a/imageurl/ta502897bm.webp)
TA502897BM 100 µL
FGF21 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B9]
Sign In for Pricing
View Details 
BNC940315-500 1x 500 µL
Heparan Sulphate Proteoglycan (A7L6), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 