Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Osteocalcin (BGLAP)

Product Specifications

Product Name Alternative

Bone Gla protein; BGP; Gamma-carboxyglutamic acid-containing protein

Abbreviation

Recombinant Bovine BGLAP protein

Gene Name

BGLAP

UniProt

P02820

Expression Region

52-100aa

Organism

Bos taurus (Bovine)

Target Sequence

YLDHWLGAPAPYPDPLEPKREVCELNPDCDELADHIGFQEAYRRFYGPV

Tag

N-terminal 6xHis-KSI-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

The carboxylated form is one of the main organic components of the bone matrix, which constitutes 1-2% of the total bone protein.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ANKRD55 activation kit by CRISPRa
GA112576 1 Kit

Human ANKRD55 activation kit by CRISPRa

Sign In for Pricing
View Details
AK3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A1]
TA501819BM 100 µL

AK3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A1]

Sign In for Pricing
View Details
Benchtop Shaking Incubator BSBT-2202
BSBT-2202 1 Unit

Benchtop Shaking Incubator BSBT-2202

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD8a Antibody[YTS 105.18]
AN00331UM-01 25 µg

Elab Fluor® 647 Anti-Mouse CD8a Antibody[YTS 105.18]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD8a Antibody[YTS 105.18]
AN00331UM-02 100 µg

Elab Fluor® 647 Anti-Mouse CD8a Antibody[YTS 105.18]

Sign In for Pricing
View Details
Mouse Scly activation kit by CRISPRa
GA205387 1 Kit

Mouse Scly activation kit by CRISPRa

Sign In for Pricing
View Details