REG-3 alpha/REG3A, Human (HEK293, His)
The REG-3 alpha/REG3A protein is a bactericidal C-type lectin that selectively targets Gram-positive bacteria by binding to the peptidoglycan carbohydrate moiety. Its antimicrobial action extends to membrane phospholipid binding, forming pores that help eliminate bacteria. REG-3 alpha/REG3A Protein, Human (HEK293, His) is the recombinant human-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
REG-3 alpha/REG3A Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/reg3a-protein-human-hek293-his.html
Purity
95.00
Smiles
EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
Molecular Formula
5068 (Gene_ID) Q06141-1 (E27-D175) (Accession)
Molecular Weight
Approximately 18 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
![Elab Fluor® 700 Anti-Mouse IL-17A Antibody[17F3]](https://cdn.genprice.uk/products/763/68dd149f061270361e7d0349/imageurl/e-ab-f1272um1.webp)
Elab Fluor® 700 Anti-Mouse IL-17A Antibody[17F3]
Elab Fluor® 700 Anti-Mouse IL-17A Antibody[17F3]
OPA1 (Dynamin-like 120kD Protein, Mitochondrial, Optic Atrophy Protein 1, KIAA0567) APC
OPA1 (Dynamin-like 120kD Protein, Mitochondrial, Optic Atrophy Protein 1, KIAA0567) APC