Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANTES/CCL5, Mouse

RANTES/CCL5 Protein, Mouse is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis. RANTES/CCL5 Protein, Mouse is a recombinant mouse CCL5 (S24-S91) protein expressed by E. coli[1].

Product Specifications

Product Name Alternative

RANTES/CCL5 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rantes-ccl5-protein-mouse.html

Purity

98.95

Smiles

SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS

Molecular Formula

20304 (Gene_ID) P30882 (S24-S91) (Accession)

Molecular Weight

Approximately 5-10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]V Appay, et al. RANTES: a versatile and controversial chemokine. Trends Immunol. 2001 Feb;22 (2) :83-7.|[2]Zhen Zeng, et al. CCL5/CCR5 axis in human diseases and related treatments. Genes Dis. 2022 Jan;9 (1) :12-27.|[3]F Cocchi, et al. Identification of RANTES, MIP-1 alpha, and MIP-1 beta as the major HIV-suppressive factors produced by CD8+ T cells. Science. 1995 Dec 15;270 (5243) :1811-5.|[4]Sara González-Rodríguez, et al. Hyperalgesic and hypoalgesic mechanisms evoked by the acute administration of CCL5 in mice. Brain Behav Immun. 2017 May;62:151-161.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGLV4-3 (IGLV43, V5-1)
470040 50 µL

IGLV4-3 (IGLV43, V5-1)

Sign In for Pricing
View Details
HNF-3α Lentiviral Activation Particles (h2)
sc-400743-LAC-2 200 µL

HNF-3α Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
(3-Aminophenyl) -N- (4-oxachroman-6-yl) formamide
FA169412-01 1000 mg

(3-Aminophenyl) -N- (4-oxachroman-6-yl) formamide

Sign In for Pricing
View Details
(3-Aminophenyl) -N- (4-oxachroman-6-yl) formamide
FA169412-02 2000 mg

(3-Aminophenyl) -N- (4-oxachroman-6-yl) formamide

Sign In for Pricing
View Details
(3-Aminophenyl) -N- (4-oxachroman-6-yl) formamide
FA169412-03 5000 mg

(3-Aminophenyl) -N- (4-oxachroman-6-yl) formamide

Sign In for Pricing
View Details
(3-Aminophenyl) -N- (4-oxachroman-6-yl) formamide
FA169412-04 10000 mg

(3-Aminophenyl) -N- (4-oxachroman-6-yl) formamide

Sign In for Pricing
View Details