Cathepsin B, Human (HEK293, His)
Cathepsin B Protein, Human (HEK293, His) functions in intracellular protein catabolism and in certain situations may also be involved in other physiological processes, such as processing of antigens in the immune response, hormone activation and bone turnover[1].
Product Specifications
Product Name Alternative
Cathepsin B Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cathepsin-b-protein-human-hek293-c-his.html
Purity
98.0
Smiles
RSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI
Molecular Formula
1508 (Gene_ID) P07858 (R18-I339) (Accession)
Molecular Weight
Approximately 35-45 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880009-500 1x 500 µL
MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040965-100 1x 100 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882216-100 1x 100 µL
CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400012-100 1x 100 µL
Tyrosinase (T311), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940460-500 1x 500 µL
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details