Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin B, Human (HEK293, His)

Cathepsin B Protein, Human (HEK293, His) functions in intracellular protein catabolism and in certain situations may also be involved in other physiological processes, such as processing of antigens in the immune response, hormone activation and bone turnover[1].

Product Specifications

Product Name Alternative

Cathepsin B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-b-protein-human-hek293-c-his.html

Purity

98.0

Smiles

RSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI

Molecular Formula

1508 (Gene_ID) P07858 (R18-I339) (Accession)

Molecular Weight

Approximately 35-45 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trimyristin
330105 5.0g

Trimyristin

Sign In for Pricing
View Details
Anti Dechloromonas Carbonic Anhydrase Pab
272608 100 µg

Anti Dechloromonas Carbonic Anhydrase Pab

Sign In for Pricing
View Details
(R) -4- (1-aminoethyl) benzoic acid
OR1006563-01 250 mg

(R) -4- (1-aminoethyl) benzoic acid

Sign In for Pricing
View Details
(R) -4- (1-aminoethyl) benzoic acid
OR1006563-02 1 g

(R) -4- (1-aminoethyl) benzoic acid

Sign In for Pricing
View Details
(R) -4- (1-aminoethyl) benzoic acid
OR1006563-03 5 g

(R) -4- (1-aminoethyl) benzoic acid

Sign In for Pricing
View Details
(R) -4- (1-aminoethyl) benzoic acid
OR1006563-04 10 g

(R) -4- (1-aminoethyl) benzoic acid

Sign In for Pricing
View Details