Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD84/SLAMF5, Human (Biotinylated, HEK293, His-Avi)

CD84/SLAMF5 protein is a self-ligand receptor in the SLAM family that regulates the activities of various immune cells through homotypic or heterotypic cell-cell interactions. It fine-tunes its function based on the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. CD84/SLAMF5 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD84/SLAMF5 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD84/SLAMF5 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd84-slamf5-protein-human-hek-293-his-avi.html

Smiles

KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFR

Molecular Formula

8832 (Gene_ID) Q9UIB8-1 (K22-R220) (Accession)

Molecular Weight

Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL
BNC680630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF647 conjugate, 0.1mg/mL
BNC470851-100 1x 100 µL

HSP60 (LK1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF740 conjugate, 0.1mg/mL
BNC740345-500 1x 500 µL

CD4 (EDU-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL
BNC040204-500 1x 500 µL

Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
BNC880225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
BNC880008-500 1x 500 µL

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details