Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G antigen 7 (GAGE7)

Product Specifications

Product Name Alternative

GAGE-7; AL4; Cancer/testis antigen 4.7; CT4.7; GAGE-12I; GAGE-7B; GAGE-8

Abbreviation

Recombinant Human GAGE7 protein

Gene Name

GAGE7

UniProt

O76087

Expression Region

1-117aa

Organism

Homo sapiens (Human)

Target Sequence

MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM22 (Extracellular) Antibody
abx443261 100 µg

ADAM22 (Extracellular) Antibody

Sign In for Pricing
View Details
Nqo1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7530804 1.0 µg DNA

Nqo1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Troponin I, Cardiac (cTnI, CMH7, Familial Hypertrophic Cardiomyopathy 7, MGC116817, TNNC1, Troponin I Type 3 Cardiac, TNNI3) discontinued
136739 1 mg

Troponin I, Cardiac (cTnI, CMH7, Familial Hypertrophic Cardiomyopathy 7, MGC116817, TNNC1, Troponin I Type 3 Cardiac, TNNI3) discontinued

Sign In for Pricing
View Details
Meis2 (NM_001107758) Rat Tagged Lenti ORF Clone
RR205243L3 10 µg

Meis2 (NM_001107758) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RSPO4 Protein Vector (Human) (pPM-C-His)
PV127477 500 ng

RSPO4 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
FOXI1 CRISPR/Cas9 KO Plasmid (m)
sc-420369 20 µg

FOXI1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details