Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF165, Human (P.pastoris)

VEGF165 Protein, Human (P.pastoris) is a Vascular Endothelial Growth Factor A (VEGF-A) isoform. VEGF is a heparin-binding growth factor specific for vascular endothelial cells that is able to induce angiogenesis.

Product Specifications

Product Name Alternative

VEGF165 Protein, Human (P.pastoris), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Applications

COVID-19-immunoregulation

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf165-protein-human-p-pastoris.html

Purity

96.7

Smiles

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Molecular Formula

7422 (Gene_ID) P15692-4 (A27-R191) (Accession)

Molecular Weight

Approximately 20-26 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Vempati P, et al. Extracellular regulation of VEGF: isoforms, proteolysis, and vascular patterning. Cytokine Growth Factor Rev. 2014 Feb;25 (1) :1-19.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tcte2 Mouse Gene Knockout Kit (CRISPR)
KN517355 1 Kit

Tcte2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OPTC Protein Vector (Mouse) (pPM-C-HA)
34856025 500 ng

OPTC Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
2'-Deoxy-uridine 3',5'-Bis (O-phenyl Carbonothioate)
421112-01 50 mg

2'-Deoxy-uridine 3',5'-Bis (O-phenyl Carbonothioate)

Sign In for Pricing
View Details
2'-Deoxy-uridine 3',5'-Bis (O-phenyl Carbonothioate)
421112-02 100 mg

2'-Deoxy-uridine 3',5'-Bis (O-phenyl Carbonothioate)

Sign In for Pricing
View Details
Human PDS5A shRNA Plasmid
abx958118-01 150 µg

Human PDS5A shRNA Plasmid

Sign In for Pricing
View Details
Human PDS5A shRNA Plasmid
abx958118-02 300 µg

Human PDS5A shRNA Plasmid

Sign In for Pricing
View Details