Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sushi repeat-containing protein SRPX2 (SRPX2)

Product Specifications

Product Name Alternative

Sushi-repeat protein upregulated in leukemia

Abbreviation

Recombinant Human SRPX2 protein

Gene Name

SRPX2

UniProt

O60687

Expression Region

24-465aa

Organism

Homo sapiens (Human)

Target Sequence

TWYAGSGYYPDESYNEVYAEEVPQAPALDYRVPRWCYTLNIQDGEATCYSPKGGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQMRCHALPFITSGTYTCTNGVLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGATCEYHCDGGYDRQGTPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFYEKQRLLIISAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVLIDKQGIDRDRYMEPVTPEEIFTFIDDYLLSNQELTQRREQRDICE

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Acts as a ligand for the urokinase plasminogen activator surface receptor. Plays a role in angiogenesis by inducing endothelial cell migration and the formation of vascular network (cords) . Involved in cellular migration and adhesion. Increases the phosphorylation levels of FAK. Interacts with and increases the mitogenic activity of HGF. Promotes synapse formation. May have a role in the perisylvian region, critical for language and cognitive development.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

57.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC8E (NM_025061) Human Untagged Clone
SC111325 10 µg

LRRC8E (NM_025061) Human Untagged Clone

Sign In for Pricing
View Details
SSBP3 Antibody
CSB-PA880121LA01HU-01 50 µg

SSBP3 Antibody

Sign In for Pricing
View Details
SSBP3 Antibody
CSB-PA880121LA01HU-02 100 µg

SSBP3 Antibody

Sign In for Pricing
View Details
Human ADD1 Pre-designed siRNA Set B
SI000319B 1 Each

Human ADD1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
1- (1-Naphthyl) ethylazide-d3
018014 10 mg

1- (1-Naphthyl) ethylazide-d3

Sign In for Pricing
View Details
ZNF192 Peptide - N-terminal region
orb2019428 100 µg

ZNF192 Peptide - N-terminal region

Sign In for Pricing
View Details