Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR3DL3/CD158z, Human (HEK293, His)

KIR3DL3/CD158z, on natural killer cells, potentially inhibits NK cell activity, contributing to the prevention of cell lysis. This regulatory role underscores the significance of KIR3DL3 in modulating NK cell functions and maintaining immune homeostasis. KIR3DL3/CD158z Protein, Human (HEK293, His) is the recombinant human-derived KIR3DL3/CD158z protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

KIR3DL3/CD158z Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kir3dl3-cd158z-protein-human-hek293-his.html

Purity

98.0

Smiles

QDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSLSKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITEDPLRLVGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENVTLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFPLGPVTHGGNYRCFGSFRALPHAWSDPSDPLPVSVTGNSRHL

Molecular Formula

115653 (Gene_ID) Q8N743/NP_703144.2 (Q26-L322) (Accession)

Molecular Weight

Approximately 40-50 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COL25A1 Polyclonal Antibody
MBS2561599-01 0.02 mL

COL25A1 Polyclonal Antibody

Sign In for Pricing
View Details
COL25A1 Polyclonal Antibody
MBS2561599-02 0.06 mL

COL25A1 Polyclonal Antibody

Sign In for Pricing
View Details
COL25A1 Polyclonal Antibody
MBS2561599-03 0.12 mL

COL25A1 Polyclonal Antibody

Sign In for Pricing
View Details
COL25A1 Polyclonal Antibody
MBS2561599-04 0.2 mL

COL25A1 Polyclonal Antibody

Sign In for Pricing
View Details
COL25A1 Polyclonal Antibody
MBS2561599-05 5x 0.2 mL

COL25A1 Polyclonal Antibody

Sign In for Pricing
View Details
Tris-HEPES-SDS Running Buffer 10X, pH 8.0
42020395-3 2 L

Tris-HEPES-SDS Running Buffer 10X, pH 8.0

Sign In for Pricing
View Details