Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A2, Human

The S100A2 protein is a potential calcium sensor that actively promotes cellular calcium signaling and affects various physiological processes. As a homodimer, it interacts with TPR-containing proteins, including FKBP4, and participates in multiple molecular associations. S100A2 Protein, Human is the recombinant human-derived S100A2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

S100A2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a2-protein-human.html

Purity

95.0

Smiles

MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP

Molecular Formula

6273 (Gene_ID) P29034 (M1-P98) (Accession)

Molecular Weight

Approximately 10.53 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Complement C5 Recombinant Rabbit Monoclonal Antibody [PSH06-45] - BSA and Azide free (Capture)
HA722682 100 µL

Human Complement C5 Recombinant Rabbit Monoclonal Antibody [PSH06-45] - BSA and Azide free (Capture)

Sign In for Pricing
View Details
IFITM5 (NM_001025295) Human Over-expression Lysate
LY422431 100 µg

IFITM5 (NM_001025295) Human Over-expression Lysate

Sign In for Pricing
View Details
ARTN Antibody
KC-27579-01 50 μL

ARTN Antibody

Sign In for Pricing
View Details
ARTN Antibody
KC-27579-02 100 µL

ARTN Antibody

Sign In for Pricing
View Details
ARTN Antibody
KC-27579-03 1 mL

ARTN Antibody

Sign In for Pricing
View Details
Recombinant Human PFN1 Protein (Gst Tag)
PDEH100591-01 20 µg

Recombinant Human PFN1 Protein (Gst Tag)

Sign In for Pricing
View Details