Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A2, Human

The S100A2 protein is a potential calcium sensor that actively promotes cellular calcium signaling and affects various physiological processes. As a homodimer, it interacts with TPR-containing proteins, including FKBP4, and participates in multiple molecular associations. S100A2 Protein, Human is the recombinant human-derived S100A2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

S100A2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a2-protein-human.html

Purity

95.0

Smiles

MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP

Molecular Formula

6273 (Gene_ID) P29034 (M1-P98) (Accession)

Molecular Weight

Approximately 10.53 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAK1/2/3 (Ab-423/402/421) Antibody
8B0540-AAT 50 µg

PAK1/2/3 (Ab-423/402/421) Antibody

Sign In for Pricing
View Details
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2168), CF405S conjugate, 0.1mg/mL
BNC042168-500 1x 500 µL

Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2168), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human OX40/TNFRSF4 Protein (mFc Tag)
PKSH033789-01 10 µg

Recombinant Human OX40/TNFRSF4 Protein (mFc Tag)

Sign In for Pricing
View Details
Recombinant Human OX40/TNFRSF4 Protein (mFc Tag)
PKSH033789-02 50 µg

Recombinant Human OX40/TNFRSF4 Protein (mFc Tag)

Sign In for Pricing
View Details
8-O-Benzyl Carmoterol Hydrochloride
TRC-B233100-1MG 1 mg

8-O-Benzyl Carmoterol Hydrochloride

Sign In for Pricing
View Details
Involucrin (IVL) Rabbit Polyclonal Antibody
AP06184PU-N 100 µg

Involucrin (IVL) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details