Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A2, Human

The S100A2 protein is a potential calcium sensor that actively promotes cellular calcium signaling and affects various physiological processes. As a homodimer, it interacts with TPR-containing proteins, including FKBP4, and participates in multiple molecular associations. S100A2 Protein, Human is the recombinant human-derived S100A2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

S100A2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a2-protein-human.html

Purity

95.0

Smiles

MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP

Molecular Formula

6273 (Gene_ID) P29034 (M1-P98) (Accession)

Molecular Weight

Approximately 10.53 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSBP3 CRISPRa sgRNA lentivector (set of three targets)(Rat)
45534126 3x 1.0µg DNA

SSBP3 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Human PHF7 (NM_016483) AAV Particle
RC205192A1V 250 µL

Human PHF7 (NM_016483) AAV Particle

Sign In for Pricing
View Details
P62-mediated mitophagy inducer 100mg
A18907-100 100 mg

P62-mediated mitophagy inducer 100mg

Sign In for Pricing
View Details
SLC40A1 Rat Pre-designed siRNA Set A
HY-RS13245 1 Set

SLC40A1 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Silver (I) fluoride
sc-236882 5 g

Silver (I) fluoride

Sign In for Pricing
View Details
TIE-2/VEGFR-2 kinase-IN-3
T79858-01 5 mg

TIE-2/VEGFR-2 kinase-IN-3

Sign In for Pricing
View Details