Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDF-1 beta/CXCL12, Human (72a.a)

SDF-1 beta (Stromal-derived factor-1β, SDF-1β) is a stromal derived CXC chemokine that signal through the CXCR4 receptor. SDF-1β has chemotactic activity on B and T cells[1][2]. SDF-1 beta/CXCL12 Protein, Human (72a.a) is produced in E. coli, and consists of 72 amino acids (K22-M93) .

Product Specifications

Product Name Alternative

SDF-1 beta/CXCL12 Protein, Human (72a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sdf-1-beta-cxcl12-protein-human-72a-a.html

Purity

97.00

Smiles

KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM

Molecular Formula

6387 (Gene_ID) P48061-1 (K22-M93) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Kryczek I, et al. Stroma-derived factor (SDF-1/CXCL12) and human tumor pathogenesis. Am J Physiol Cell Physiol. 2007 Mar;292 (3) :C987-95.|[2]Maria De La Luz Sierra, et al. Differential processing of stromal-derived factor-1alpha and stromal-derived factor-1beta explains functional diversity. Blood. 2004 Apr 1;103 (7) :2452-9.|[3]Zheng Jiang, et al. Contribution of SDF-1α/CXCR4 signaling to brain development and glioma progression. Neurosignals. 2013;21 (3-4) :240-58.|[4]Miroslaw Janowski. Functional diversity of SDF-1 splicing variants. Cell Adh Migr. 2009 Jul-Sep;3 (3) :243-9.|[5]Kleanthis Fytianos, et al. Anti-Fibrotic Effect of SDF-1β Overexpression in Bleomycin-Injured Rat Lung. Pharmaceutics. 2022 Aug 27;14 (9) :1803.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Compound N032-0001
MBS5796240 Inquire

Compound N032-0001

Sign In for Pricing
View Details
Bovine Arrestin domain-containing protein 4 (ARRDC4) ELISA Kit
MBS7233118-01 48 Well

Bovine Arrestin domain-containing protein 4 (ARRDC4) ELISA Kit

Sign In for Pricing
View Details
Bovine Arrestin domain-containing protein 4 (ARRDC4) ELISA Kit
MBS7233118-02 96 Well

Bovine Arrestin domain-containing protein 4 (ARRDC4) ELISA Kit

Sign In for Pricing
View Details
Bovine Arrestin domain-containing protein 4 (ARRDC4) ELISA Kit
MBS7233118-03 5x 96 Well

Bovine Arrestin domain-containing protein 4 (ARRDC4) ELISA Kit

Sign In for Pricing
View Details
Bovine Arrestin domain-containing protein 4 (ARRDC4) ELISA Kit
MBS7233118-04 10x 96 Well

Bovine Arrestin domain-containing protein 4 (ARRDC4) ELISA Kit

Sign In for Pricing
View Details
Fam125a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
19747116 3x 1.0 µg

Fam125a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details