Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Dihydrofolate reductase (folA)

Product Specifications

Product Name Alternative

DHFR

Abbreviation

Recombinant Staphylococcus epidermidis folA protein

Gene Name

FolA

UniProt

P0C0P1

Expression Region

1-161aa

Organism

Staphylococcus epidermidis (strain ATCC 12228)

Target Sequence

MTLSIIVAHDKQRVIGYQNQLPWHLPNDLKHVKQLTTGNTLVMGRKTFNSIGKPLPNRRNVVLTNQASFHHEGVDVINSLDEIKELSGHVFIFGGQTLFEAMIDQVDDMYITVIDGKFQGDTFFPPYTFENWEVESSVEGQLDEKNTIPHTFLHLVRRKGK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (4-bromophenoxy) nicotinic acid
sc-339817 250 mg

2- (4-bromophenoxy) nicotinic acid

Sign In for Pricing
View Details
Rabbit Nucleus Pulposus Cell Complete Medium
CM-Rb031-01 100 mL

Rabbit Nucleus Pulposus Cell Complete Medium

Sign In for Pricing
View Details
Rabbit Nucleus Pulposus Cell Complete Medium
CM-Rb031-02 4x 125 mL

Rabbit Nucleus Pulposus Cell Complete Medium

Sign In for Pricing
View Details
Mouse Galectin 7 ELISA Kit
CEK1467 96 Tests

Mouse Galectin 7 ELISA Kit

Sign In for Pricing
View Details
EPDR1 (Ependymin Related Protein 1, EPDR, Mammalian Ependymin Related Protein 1, MERP1, MERP-1, Upregulated in Colorectal Cancer Gene 1, UCC1) (PE)
MBS6377491-01 0.1 mL

EPDR1 (Ependymin Related Protein 1, EPDR, Mammalian Ependymin Related Protein 1, MERP1, MERP-1, Upregulated in Colorectal Cancer Gene 1, UCC1) (PE)

Sign In for Pricing
View Details
EPDR1 (Ependymin Related Protein 1, EPDR, Mammalian Ependymin Related Protein 1, MERP1, MERP-1, Upregulated in Colorectal Cancer Gene 1, UCC1) (PE)
MBS6377491-02 5x 0.1 mL

EPDR1 (Ependymin Related Protein 1, EPDR, Mammalian Ependymin Related Protein 1, MERP1, MERP-1, Upregulated in Colorectal Cancer Gene 1, UCC1) (PE)

Sign In for Pricing
View Details