Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD20/MS4A1, Mouse (P.pastoris, His)

CD20/MS4A1 protein regulates cellular calcium influx, essential for B-lymphocyte development, differentiation, and activation. It activates store-operated calcium channels, allowing calcium influx through B-cell receptor/BCR activation. CD20/MS4A1 protein forms homotetramers and interacts with cell surface IgM chains, the antigen-binding parts of the BCR. CD20/MS4A1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived CD20/MS4A1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CD20/MS4A1 Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd20-protein-mouse-p-pastoris-his.html

Purity

94.00

Smiles

VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP

Molecular Formula

12482 (Gene_ID) P19437 (V111-P291) (Accession)

Molecular Weight

Approximately 33 kDa.The reducing (R) protein migrat es as 33 kDa in SDS-PAGE may be due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2712), CF594 conjugate, 0.1mg/mL
BNC942712-100 1x 100 µL

Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2712), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS512123 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Mono(3-carboxypropyl) Phthalate-d4
TRC-M525637-25MG 25 mg

Mono(3-carboxypropyl) Phthalate-d4

Sign In for Pricing
View Details
CAPN8 (NM_001143962) Human Over-expression Lysate
LC428425 20 µg

CAPN8 (NM_001143962) Human Over-expression Lysate

Sign In for Pricing
View Details
XFD610 amine
70063-AAT 1 mg

XFD610 amine

Sign In for Pricing
View Details
NMBR Rabbit Polyclonal Antibody
AP01274PU-N 100 µg

NMBR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details