Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD20/MS4A1, Mouse (P.pastoris, His)

CD20/MS4A1 protein regulates cellular calcium influx, essential for B-lymphocyte development, differentiation, and activation. It activates store-operated calcium channels, allowing calcium influx through B-cell receptor/BCR activation. CD20/MS4A1 protein forms homotetramers and interacts with cell surface IgM chains, the antigen-binding parts of the BCR. CD20/MS4A1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived CD20/MS4A1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CD20/MS4A1 Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd20-protein-mouse-p-pastoris-his.html

Purity

94.00

Smiles

VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP

Molecular Formula

12482 (Gene_ID) P19437 (V111-P291) (Accession)

Molecular Weight

Approximately 33 kDa.The reducing (R) protein migrat es as 33 kDa in SDS-PAGE may be due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BDE 66
TRC-B119215-5MG 5 mg

BDE 66

Sign In for Pricing
View Details
Purified Anti-Human CD66e Antibody[A5B7]
AN004750P-01 25 µg

Purified Anti-Human CD66e Antibody[A5B7]

Sign In for Pricing
View Details
Purified Anti-Human CD66e Antibody[A5B7]
AN004750P-02 100 µg

Purified Anti-Human CD66e Antibody[A5B7]

Sign In for Pricing
View Details
2-Hexynyl-5'-N-ethylcarboxamidoadenosine
TRC-H325500-5MG 5 mg

2-Hexynyl-5'-N-ethylcarboxamidoadenosine

Sign In for Pricing
View Details
Glutathione S-Transferase Mu3 (GSTM3) (CPTC-GSTMu3-1), CF740 conjugate, 0.1mg/mL
BNC742243-100 1x 100 µL

Glutathione S-Transferase Mu3 (GSTM3) (CPTC-GSTMu3-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ethyl 3-Oxododecanoate
TRC-B435193-500MG 500 mg

Ethyl 3-Oxododecanoate

Sign In for Pricing
View Details