Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD20/MS4A1, Mouse (P.pastoris, His)

CD20/MS4A1 protein regulates cellular calcium influx, essential for B-lymphocyte development, differentiation, and activation. It activates store-operated calcium channels, allowing calcium influx through B-cell receptor/BCR activation. CD20/MS4A1 protein forms homotetramers and interacts with cell surface IgM chains, the antigen-binding parts of the BCR. CD20/MS4A1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived CD20/MS4A1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CD20/MS4A1 Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd20-protein-mouse-p-pastoris-his.html

Purity

94.00

Smiles

VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP

Molecular Formula

12482 (Gene_ID) P19437 (V111-P291) (Accession)

Molecular Weight

Approximately 33 kDa.The reducing (R) protein migrat es as 33 kDa in SDS-PAGE may be due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C3orf80 activation kit by CRISPRa
GA118307 1 Kit

Human C3orf80 activation kit by CRISPRa

Sign In for Pricing
View Details
Human DEFB114 activation kit by CRISPRa
GA116705 1 Kit

Human DEFB114 activation kit by CRISPRa

Sign In for Pricing
View Details
Apolipoprotein F (APOF) (NM_001638) Human Over-expression Lysate
LC400616 20 µg

Apolipoprotein F (APOF) (NM_001638) Human Over-expression Lysate

Sign In for Pricing
View Details
Human TMEM63B activation kit by CRISPRa
GA110737 1 Kit

Human TMEM63B activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS621863 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
Recombinant Human Reticulocalbin 3/RCN3 Protein (aa 21-328, His Tag)
PKSH033292-01 10 µg

Recombinant Human Reticulocalbin 3/RCN3 Protein (aa 21-328, His Tag)

Sign In for Pricing
View Details