Question 1

What is the catalog number for CDC25A Antibody?

Accepted Answer

The catalog number for CDC25A Antibody is MBS8504602.

Question 2

What sizes are available for CDC25A Antibody?

Accepted Answer

CDC25A Antibody is available in the following size(s): 0.1 mg, 0.1 mL (AF405L), 0.1 mL (AF405S), 0.1 mL (AF610), 0.1 mL (AF635), 0.1 mL (APC), 0.1 mL (Cy3), 0.1 mL (Cy5), 0.1 mL (Cy5.5), 0.1 mL (Cy7), 0.1 mL (PE), 0.1 mL (AF546), 0.1 mL (AF405M), 0.1 mL (AF750), 0.1 mL (Biotin), 0.1 mL (HRP), 0.1 mL (FITC), 0.1 mL (AF350), 0.1 mL (AF488), 0.1 mL (AF555).

Question 3

How many pack sizes does CDC25A Antibody come in?

Accepted Answer

CDC25A Antibody is available in 20 different pack sizes.

Question 4

Is CDC25A Antibody in stock?

Accepted Answer

CDC25A Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Question 5

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

Accepted Answer

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Question 6

Is this antibody conjugated?

Accepted Answer

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

Question 7

What is the sensitivity of this ELISA kit?

Accepted Answer

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

CDC25A Antibody

Product Specifications

CAS Number

Gene Name

NCBI Gene ID

Other Gene Names

Short Name

Other Product Names

NCBI GI Number

NCBI Accession Number

NCBI GB Accession Number

Uniprot Accession Number

Available Sizes

Frequently Asked Questions

Explore Other Products

CD31 (PECAM-1, EndoCAM, PECA1, Platelet Endothelial Cell Adhesion Molecule 1, GPIIA)

Rabbit Polyclonal Caspase-4 Antibody [mFluor Violet 500 SE]

AKT2 (specific) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 8B7]

Purified Anti-Human CD45 (HI30)

Mouse Monoclonal PD-1 Antibody (7A11B1)

H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH