Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Mouse (HEK293)

The CD47 protein, also known as integrin-associated protein (IAP), is an immune checkpoint protein. CD47 binds to membrane integrins and binds ligands platelet reaction-protein-1 (TSP-1) and signal regulatory protein alpha (SIRP) . CD47 is a potential therapeutic target for some cancers and is also used to treat pulmonary fibrosis. CD47 Protein, Mouse (HEK293) is the recombinant mouse-derived CD47 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

CD47 Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-mouse-hek293-tag-free.html

Purity

98.0

Smiles

QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK

Molecular Formula

16423 (Gene_ID) Q61735-1/ADQ12919.1 (Q19-K140) (Accession)

Molecular Weight

Approximately 25-40 kDa

References & Citations

[1]Sick E, et al. Activation of CD47 receptors causes proliferation of human astrocytoma but not normal astrocytes via an Akt-dependent pathway. Glia. 2011 Feb;59 (2) :308-19.|[2]Ghantous L, et al. The DNA damage response pathway regulates the expression of the immune checkpoint CD47. Commun Biol. 2023 Mar 7;6 (1) :245.|[3]Sick E, et al. CD47 update: a multifaceted actor in the tumour microenvironment of potential therapeutic interest. Br J Pharmacol. 2012 Dec;167 (7) :1415-30.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH2D4B (C-term) Rabbit Polyclonal Antibody
AP53898PU-N 400 µL

SH2D4B (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GRIK4 Rabbit Polyclonal Antibody
HA500017 100 µL

GRIK4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WDR79 (WRAP53) (NM_001143991) Human Recombinant Protein
TP327773M 100 µg

WDR79 (WRAP53) (NM_001143991) Human Recombinant Protein

Sign In for Pricing
View Details
ADAR1 (ADAR) (NM_001025107) Human Recombinant Protein
TP762358 50 µg

ADAR1 (ADAR) (NM_001025107) Human Recombinant Protein

Sign In for Pricing
View Details
SGK3 (C8orf44-SGK3) (N-term) Rabbit Polyclonal Antibody
AP14834PU-N 400 µL

SGK3 (C8orf44-SGK3) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Aldolase B, Fructose Bisphosphate (ALDOB) ELISA Kit
RD-ALDOB-Hu-01 96 Tests

Human Aldolase B, Fructose Bisphosphate (ALDOB) ELISA Kit

Sign In for Pricing
View Details