Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ephrin-B2/EFNB2, Mouse (HEK293, Fc-His)

Ephrin-B2/EFNB2 Protein is a transmembrane ligand for Eph receptors, mediating bidirectional signaling and binding to EPHA4, EPHA3, and EPHB4. It regulates cell adhesion, migration, heart morphogenesis, angiogenesis, and axon orientation. It also interacts with PDZRN3. Ephrin-B2/EFNB2 Protein, Mouse (HEK293, Fc-His) is the recombinant mouse-derived Ephrin-B2/EFNB2 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

Product Specifications

Product Name Alternative

Ephrin-B2/EFNB2 Protein, Mouse (HEK293, Fc-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ephrin-b2-efnb2-protein-mouse-hek293-fc-his.html

Purity

95.0

Smiles

RSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSARNHGPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNLLGSE

Molecular Formula

13642 (Gene_ID) P52800 (R29-E227) (Accession)

Molecular Weight

65-80 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Endometrium
CS620466 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
Kv4.2 / KCND2 Recombinant Mouse monoclonal Antibody
HA601434 100 µL

Kv4.2 / KCND2 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
IPG -4 AM - yellow -green fluorescent potassium indicator
3021C 500 µg

IPG -4 AM - yellow -green fluorescent potassium indicator

Sign In for Pricing
View Details
TRMT1 (TRMU) Human Gene Knockout Kit (CRISPR)
KN419032 1 Kit

TRMT1 (TRMU) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RANTES (CCL5) Mouse Monoclonal Antibody [Clone ID: OTI10G5]
CF806662 100 µg

RANTES (CCL5) Mouse Monoclonal Antibody [Clone ID: OTI10G5]

Sign In for Pricing
View Details
CDK5RAP1 Rabbit Polyclonal Antibody
TA374566 100 µL

CDK5RAP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details