Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GrpE protein homolog 1, mitochondrial (GRPEL1)

Product Specifications

CAS Number

9000-83-3

Gene Name

GRPEL1

UniProt

Q9HAV7

Expression Region

28-217aa

Organism

Homo sapiens

Target Sequence

CTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA

Tag

N-terminal GST-tagged

Source

E.coli

Field of Research

Signal Transduction

Assay Type

Developed Protein

Relevance

Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins.

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length of Mature Protein

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

48.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Quiescin Q6 (QSOX1) (NM_002826) Human Tagged ORF Clone
RC215121 10 µg

Quiescin Q6 (QSOX1) (NM_002826) Human Tagged ORF Clone

Sign In for Pricing
View Details
GFRA3, ID (GFRA3, GDNF family receptor alpha-3) (MaxLight 550)
MBS6302002-01 0.1 mL

GFRA3, ID (GFRA3, GDNF family receptor alpha-3) (MaxLight 550)

Sign In for Pricing
View Details
GFRA3, ID (GFRA3, GDNF family receptor alpha-3) (MaxLight 550)
MBS6302002-02 5x 0.1 mL

GFRA3, ID (GFRA3, GDNF family receptor alpha-3) (MaxLight 550)

Sign In for Pricing
View Details
GENLISA Rat Tyrosine-Protein Kinase Fyn (FYN) ELISA
KLR5811 1x 96 Well

GENLISA Rat Tyrosine-Protein Kinase Fyn (FYN) ELISA

Sign In for Pricing
View Details
Lentiviral human LHPP shRNA (UAS) - Lentiviral human LHPP shRNA (UAS) (25)
GTR15157913 1 Vial

Lentiviral human LHPP shRNA (UAS) - Lentiviral human LHPP shRNA (UAS) (25)

Sign In for Pricing
View Details
T2R7 Expressing HEK293T Cell Line
T6139 1x106 cells / 1.0 mL

T2R7 Expressing HEK293T Cell Line

Sign In for Pricing
View Details