Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTLA/CD272, Rat (HEK293, mFc)

BTLA/CD272 protein inhibits antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2. It regulates immune responses through cis and trans interactions with TNFRSF14. In cis, it maintains resting state in naive T cells, while in trans, it supports survival signals in effector T cells. BTLA/CD272 interacts with PTPN6/SHP-1, PTPN11/SHP-2, and TNFRSF14/HVEM. BTLA/CD272 Protein, Rat (HEK293, mFc) is the recombinant rat-derived BTLA/CD272 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

BTLA/CD272 Protein, Rat (HEK293, mFc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btla-cd272-protein-rat-hek293-mfc.html

Purity

96.00

Smiles

KEPTKRIGEECRVQLKIKRNSSRSAWTGELFKIECPVTYCVHRPNVTWCKHNGTRCVPLEVGPQLHTSWVENDQASAFVLYFEPIHLSDDGVYTCSANLNSEVINSHSVVIHVTERTQNCSEHPLITASDIPDATNASRPSTMEERPGRTWLLY

Molecular Formula

407756 (Gene_ID) Q6PNM1 (K30-Y183) (Accession)

Molecular Weight

Approximately 55-77 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Anti Acetylcholine Antibody ELISA Kit
MBS7277832-01 48 Well

Monkey Anti Acetylcholine Antibody ELISA Kit

Sign In for Pricing
View Details
Monkey Anti Acetylcholine Antibody ELISA Kit
MBS7277832-02 96 Well

Monkey Anti Acetylcholine Antibody ELISA Kit

Sign In for Pricing
View Details
Monkey Anti Acetylcholine Antibody ELISA Kit
MBS7277832-03 5x 96 Well

Monkey Anti Acetylcholine Antibody ELISA Kit

Sign In for Pricing
View Details
Monkey Anti Acetylcholine Antibody ELISA Kit
MBS7277832-04 10x 96 Well

Monkey Anti Acetylcholine Antibody ELISA Kit

Sign In for Pricing
View Details
PLVAP Antibody Blocking Peptide
orb1513868 500 µg

PLVAP Antibody Blocking Peptide

Sign In for Pricing
View Details
SOD (EC) Antibody: Biotin
MBS806196-01 0.1 mg

SOD (EC) Antibody: Biotin

Sign In for Pricing
View Details