Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Allergin-1 (MILR1), partial

Product Specifications

Product Name Alternative

Allergy inhibitory receptor 1; Mast cell antigen 32; MCA-32; Mast cell immunoglobulin-like receptor 1

Abbreviation

Recombinant Human MILR1 protein, partial

Gene Name

MILR1

UniProt

Q7Z6M3

Expression Region

249-343aa

Organism

Homo sapiens (Human)

Target Sequence

LPKYKTRKAMRNNVPRDRGDTAMEVGIYANILEKQAKEESVPEVGSRPCVSTAQDEAKHSQELQYATPVFQEVAPREQEACDSYKSGYVYSELNF

Tag

N-terminal 6xHis-KSI-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Immunoglobulin-like receptor which plays an inhibitory role in degranulation of mast cells. Negatively regulates IgE-mediated mast cell activation and suppresses the type I immediate hypersensitivity reaction.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL
BNC680630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF647 conjugate, 0.1mg/mL
BNC470851-100 1x 100 µL

HSP60 (LK1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF740 conjugate, 0.1mg/mL
BNC740345-500 1x 500 µL

CD4 (EDU-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL
BNC040204-500 1x 500 µL

Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
BNC880225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
BNC880008-500 1x 500 µL

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details