Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bothrops atrox Thrombin-like enzyme batroxobin

Product Specifications

Product Name Alternative

BX; SVTLE; Bothrops atrox serine proteinase; Defibrase; Fibrinogen-clotting enzyme; Reptilase; Snake venom serine protease; SVSP; Venombin A

Abbreviation

Recombinant Bothrops atrox Thrombin-like enzyme batroxobin protein

UniProt

P04971

Expression Region

25-255aa

Organism

Bothrops atrox (Barba amarilla) (Fer-de-lance)

Target Sequence

VIGGDECDINEHPFLAFMYYSPRYFCGMTLINQEWVLTAAHCNRRFMRIHLGKHAGSVANYDEVVRYPKEKFICPNKKKNVITDKDIMLIRLDRPVKNSEHIAPLSLPSNPPSVGSVCRIMGWGAITTSEDTYPDVPHCANINLFNNTVCREAYNGLPAKTLCAGVLQGGIDTCGGDSGGPLICNGQFQGILSWGSDPCAEPRKPAFYTKVFDYLPWIQSIIAGNKTATCP

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Thrombin-like snake venom serine protease. Cleaves Arg-Gly bonds in fibrinogen alpha chains (FGA) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pycard Rat shRNA Lentiviral Particle (Locus ID 282817)
TL713312V 500 µL Each

Pycard Rat shRNA Lentiviral Particle (Locus ID 282817)

Sign In for Pricing
View Details
PQLC1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
37517156 3x 1.0 µg DNA

PQLC1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Anti-UGP2 Antibody
CQA9800-01 30 µL

Anti-UGP2 Antibody

Sign In for Pricing
View Details
Anti-UGP2 Antibody
CQA9800-02 50 μL

Anti-UGP2 Antibody

Sign In for Pricing
View Details
Anti-UGP2 Antibody
CQA9800-03 100 µL

Anti-UGP2 Antibody

Sign In for Pricing
View Details
Anti-UGP2 Antibody
CQA9800-04 200 µL

Anti-UGP2 Antibody

Sign In for Pricing
View Details