Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGR1, Human (HEK293, His)

PTGR1 is an NAD (P) H-dependent oxidoreductase that efficiently metabolizes inflammatory eicosanoids such as prostaglandins, leukotrienes, and lipoxins.It actively catalyzes the reduction of 13,14 double bonds in various 15-oxoPGs, including 15-oxo-PGE1 and 15-oxo-PGF2-alpha.PTGR1 Protein, Human (HEK293, His) is the recombinant human-derived PTGR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PTGR1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ptgr1-protein-human-hek293-his.html

Purity

90.00

Smiles

MVRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA

Molecular Formula

22949 (Gene_ID) Q14914 (M1-A329) (Accession)

Molecular Weight

Approximately 38 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OTUD3 Rabbit pAb
MBS9145695-01 0.02 mL

OTUD3 Rabbit pAb

Sign In for Pricing
View Details
OTUD3 Rabbit pAb
MBS9145695-02 0.1 mL

OTUD3 Rabbit pAb

Sign In for Pricing
View Details
OTUD3 Rabbit pAb
MBS9145695-03 5x 0.1 mL

OTUD3 Rabbit pAb

Sign In for Pricing
View Details
NA Protein (N-His, H3N2)
P519916 100 µg

NA Protein (N-His, H3N2)

Sign In for Pricing
View Details
Calcium phosphate dibasic, anhydrous, EP, USP grade
GL2117-5kg 5 Kg

Calcium phosphate dibasic, anhydrous, EP, USP grade

Sign In for Pricing
View Details
TERF2IP ORF Vector (Human) (pORF)
ORF010427 1.0 µg DNA

TERF2IP ORF Vector (Human) (pORF)

Sign In for Pricing
View Details