Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP4, Cynomolgus (HEK293, His)

RBP4 Protein, a vital retinol transporter in blood plasma, mediates the transfer from liver stores to peripheral tissues. It also enhances retinol transport by interacting with TTR. RBP4 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived RBP4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RBP4 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp4-protein-cynomolgus-hek293-his.html

Purity

98.0

Smiles

ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIIDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQRIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Molecular Formula

102136826 (Gene_ID) A0A2K5W172 (E19-L201) (Accession)

Molecular Weight

Approximately 23 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GEMIN6 (Gem-associated Protein 6, Gemin-6, SIP2, FLJ23459) (Biotin)
127268-Biotin 100 µL

GEMIN6 (Gem-associated Protein 6, Gemin-6, SIP2, FLJ23459) (Biotin)

Sign In for Pricing
View Details
MAP4K3 Protein Vector (Human) (pPM-C-HA)
PV025023 500 ng

MAP4K3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
S100A4 Antibody / S100 calcium-binding protein A4
V5789-20UG 20 µg

S100A4 Antibody / S100 calcium-binding protein A4

Sign In for Pricing
View Details
Bis (2-ethylbutyl) benzene-1,2-dicarboxylate
OR1042806-01 1 g

Bis (2-ethylbutyl) benzene-1,2-dicarboxylate

Sign In for Pricing
View Details
Bis (2-ethylbutyl) benzene-1,2-dicarboxylate
OR1042806-02 5 g

Bis (2-ethylbutyl) benzene-1,2-dicarboxylate

Sign In for Pricing
View Details
Bis (2-ethylbutyl) benzene-1,2-dicarboxylate
OR1042806-03 10 g

Bis (2-ethylbutyl) benzene-1,2-dicarboxylate

Sign In for Pricing
View Details