Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP4, Cynomolgus (HEK293, His)

RBP4 Protein, a vital retinol transporter in blood plasma, mediates the transfer from liver stores to peripheral tissues. It also enhances retinol transport by interacting with TTR. RBP4 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived RBP4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RBP4 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp4-protein-cynomolgus-hek293-his.html

Purity

98.0

Smiles

ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIIDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQRIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Molecular Formula

102136826 (Gene_ID) A0A2K5W172 (E19-L201) (Accession)

Molecular Weight

Approximately 23 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRD5A3 (NM_024592) Human Over-expression Lysate
LS079644-20ug 20 µg

SRD5A3 (NM_024592) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PCDHGC5 shRNA Plasmid
abx961046-01 150 µg

Human PCDHGC5 shRNA Plasmid

Sign In for Pricing
View Details
Human PCDHGC5 shRNA Plasmid
abx961046-02 300 µg

Human PCDHGC5 shRNA Plasmid

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS538884 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Compound N059-0002
MF-0030725-01 1 mg

Compound N059-0002

Sign In for Pricing
View Details
Compound N059-0002
MF-0030725-02 5 mg

Compound N059-0002

Sign In for Pricing
View Details