RBP4, Cynomolgus (HEK293, His)
RBP4 Protein, a vital retinol transporter in blood plasma, mediates the transfer from liver stores to peripheral tissues. It also enhances retinol transport by interacting with TTR. RBP4 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived RBP4 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
RBP4 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/rbp4-protein-cynomolgus-hek293-his.html
Purity
98.0
Smiles
ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIIDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQRIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Molecular Formula
102136826 (Gene_ID) A0A2K5W172 (E19-L201) (Accession)
Molecular Weight
Approximately 23 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740745-500 1x 500 µL
CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400668-100 1x 100 µL
MART-1 / Melan-A (A103), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472476-500 1x 500 µL
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2476), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470923-500 1x 500 µL
Myosin, Smooth Muscle Heavy Chain (MYH11/923), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882312-100 1x 100 µL
SOX10 (Melanoma Marker) (rSOX10/1074), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details