Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP4, Cynomolgus (HEK293, His)

RBP4 Protein, a vital retinol transporter in blood plasma, mediates the transfer from liver stores to peripheral tissues. It also enhances retinol transport by interacting with TTR. RBP4 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived RBP4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RBP4 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp4-protein-cynomolgus-hek293-his.html

Purity

98.0

Smiles

ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIIDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQRIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Molecular Formula

102136826 (Gene_ID) A0A2K5W172 (E19-L201) (Accession)

Molecular Weight

Approximately 23 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Galectin 1 (14kD Laminin-binding Protein, 14kD Lectin, Beta Galactoside Binding Lectin, Beta Galactoside Binding Lectin L 14 I, Beta Galactoside Binding Protein, Beta-galactoside-binding Lectin L-14-I, Gal 1, Gal-1, GAL1, Galaptin, Galbp, Galectin, Galectin-1, Galectin1, GBP, HBL, HLBP14, HPL, L 14.5, L-14.5, L14, Lactose Binding Lectin 1, Lactose-binding Lectin 1, Lect14, Lectin Galactoside Binding Soluble 1, Lectin Galactoside-binding Soluble 1, LEG1_HUMAN, LGALS 1, LGALS1, Lgals1 Lectin Galactose Binding Soluble 1, MAPK Activating Protein MP12, Putative MAPK Activating Protein MP12, Putative MAPK-activating Protein PM12, S Lac Lectin 1, S-Lac Lectin 1)
303320 100 µg

Galectin 1 (14kD Laminin-binding Protein, 14kD Lectin, Beta Galactoside Binding Lectin, Beta Galactoside Binding Lectin L 14 I, Beta Galactoside Binding Protein, Beta-galactoside-binding Lectin L-14-I, Gal 1, Gal-1, GAL1, Galaptin, Galbp, Galectin, Galectin-1, Galectin1, GBP, HBL, HLBP14, HPL, L 14.5, L-14.5, L14, Lactose Binding Lectin 1, Lactose-binding Lectin 1, Lect14, Lectin Galactoside Binding Soluble 1, Lectin Galactoside-binding Soluble 1, LEG1_HUMAN, LGALS 1, LGALS1, Lgals1 Lectin Galactose Binding Soluble 1, MAPK Activating Protein MP12, Putative MAPK Activating Protein MP12, Putative MAPK-activating Protein PM12, S Lac Lectin 1, S-Lac Lectin 1)

Sign In for Pricing
View Details
MTHFSD Rabbit Polyclonal Antibody (BF750)
orb2485227 100 µL

MTHFSD Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
GSK-872 2mg
A19871-2 2 mg

GSK-872 2mg

Sign In for Pricing
View Details
CCDC149 sgRNA CRISPR Lentivector set (Human)
K0386901 3x 1.0 µg

CCDC149 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
ALK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D7]
TA800796AM 100 µL

ALK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D7]

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12/DH10B) NAPA Polyclonal Antibody
MBS7185122 Inquire

Rabbit anti-Escherichia coli (strain K12/DH10B) NAPA Polyclonal Antibody

Sign In for Pricing
View Details