Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Lipocalin-1 (LCN1)

Product Specifications

Product Name Alternative

(Tear lipocalin) (Tlc) (Tear prealbumin) (TP) (Von Ebner gland protein) (VEG protein)

Abbreviation

Recombinant Pig LCN1 protein

Gene Name

LCN1

UniProt

P53715

Expression Region

20-176aa

Organism

Sus scrofa (Pig)

Target Sequence

QEFPAVGQPLQDLLGRWYLKAMTSDPEIPGKKPESVTPLILKALEGGDLEAQITFLIDGQCQDVTLVLKKTNQPFTFTAYDGKRVVYILPSKVKDHYILYCEGELDGQEVRMAKLVGRDPENNPEALEEFKEVARAKGLNPDIVRPQQSETCSPGGN

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Seems to play a role in testicular function. May be a trophic hormone with a role in testicular descent in fetal life. Is a ligand for LGR8 receptor.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.3 kDa

References & Citations

"The primary structure and the disulfide links of the bovine relaxin-like factor (RLF) ." Bullesbach E.E., Schwabe C. Biochemistry 41:274-281 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS622360 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Aurora C Rabbit polyclonal Antibody
ER1904-04 100 µL

Aurora C Rabbit polyclonal Antibody

Sign In for Pricing
View Details
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2153), CF594 conjugate, 0.1mg/mL
BNC942153-500 1x 500 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2153), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Kynurenic Acid
TRC-K660500-10MG 10 mg

Kynurenic Acid

Sign In for Pricing
View Details
CD25 / IL2RA (Activated Lymphocyte Marker) (IL2RA/2394), CF488A conjugate, 0.1mg/mL
BNC882394-500 1x 500 µL

CD25 / IL2RA (Activated Lymphocyte Marker) (IL2RA/2394), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Single Beam UV Visible Spectrophotometer BSSUV-202
BSSUV-202 Each

Single Beam UV Visible Spectrophotometer BSSUV-202

Sign In for Pricing
View Details