Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKK6, Human (S207D, T211D, sf9, His)

The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (S207D, T211D, sf9, His) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MKK6 Protein, Human (S207D, T211D, sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mkk6-protein-human-s207d-t211d-sf9-his.html

Purity

94.00

Smiles

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDVAKDIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Molecular Formula

5608 (Gene_ID) P52564-1 (M1-D334, S207D, T211D) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Siglec-3/CD33 Antibody (CD33 6C5/2) [DyLight 594]
NBP2-50292DL594 0.1 mL

Mouse Monoclonal Siglec-3/CD33 Antibody (CD33 6C5/2) [DyLight 594]

Sign In for Pricing
View Details
Cpt1a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4650408 1.0 µg DNA

Cpt1a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Actin ReguLatory Protein CAPG (CAPG) (NM_001747) Human Over-expression Lysate
LC419770 20 µg

Actin ReguLatory Protein CAPG (CAPG) (NM_001747) Human Over-expression Lysate

Sign In for Pricing
View Details
Human hsa-miR-532-5p miRNA Agomir
abx880314-01 5 nmol

Human hsa-miR-532-5p miRNA Agomir

Sign In for Pricing
View Details
Human hsa-miR-532-5p miRNA Agomir
abx880314-02 10 nmol

Human hsa-miR-532-5p miRNA Agomir

Sign In for Pricing
View Details
Human ALCAM MAb (Clone 105901)
MAB656-100 100 µg

Human ALCAM MAb (Clone 105901)

Sign In for Pricing
View Details