Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKK6, Human (S207D, T211D, sf9, His)

The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (S207D, T211D, sf9, His) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MKK6 Protein, Human (S207D, T211D, sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mkk6-protein-human-s207d-t211d-sf9-his.html

Purity

94.00

Smiles

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDVAKDIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Molecular Formula

5608 (Gene_ID) P52564-1 (M1-D334, S207D, T211D) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

THEM4 Human shRNA Plasmid Kit (Locus ID 117145)
TG301115 1 Kit

THEM4 Human shRNA Plasmid Kit (Locus ID 117145)

Sign In for Pricing
View Details
Mouse Monoclonal CD1e Antibody (704407) [Janelia Fluor 669]
FAB7330JF669 0.1 mL

Mouse Monoclonal CD1e Antibody (704407) [Janelia Fluor 669]

Sign In for Pricing
View Details
PVRL4 Antibody
A48385-50UL 50 μL

PVRL4 Antibody

Sign In for Pricing
View Details
Anti-Human TIGAR Polyclonal Antibody
PHN33701 100 μg

Anti-Human TIGAR Polyclonal Antibody

Sign In for Pricing
View Details
(3β,5β) -3-Hydroxycholan-24-oic acid
428302-01 50 mg

(3β,5β) -3-Hydroxycholan-24-oic acid

Sign In for Pricing
View Details
(3β,5β) -3-Hydroxycholan-24-oic acid
428302-02 250 mg

(3β,5β) -3-Hydroxycholan-24-oic acid

Sign In for Pricing
View Details