Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKK6, Human (S207D, T211D, sf9, His)

The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (S207D, T211D, sf9, His) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MKK6 Protein, Human (S207D, T211D, sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mkk6-protein-human-s207d-t211d-sf9-his.html

Purity

94.00

Smiles

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDVAKDIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Molecular Formula

5608 (Gene_ID) P52564-1 (M1-D334, S207D, T211D) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LDL Receptor (LDLR) (NM_000527) Human Tagged ORF Clone Lentiviral Particle
RC200006L2V 200 µL

LDL Receptor (LDLR) (NM_000527) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RFTN1 Protein Vector (Human) (pPM-C-HA)
PV057099 500 ng

RFTN1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Polyclonal Antibody to Granzyme A (GZMA)
MBS2139511-01 0.1 mL

Polyclonal Antibody to Granzyme A (GZMA)

Sign In for Pricing
View Details
Polyclonal Antibody to Granzyme A (GZMA)
MBS2139511-02 0.2 mL

Polyclonal Antibody to Granzyme A (GZMA)

Sign In for Pricing
View Details
Polyclonal Antibody to Granzyme A (GZMA)
MBS2139511-03 0.5 mL

Polyclonal Antibody to Granzyme A (GZMA)

Sign In for Pricing
View Details
Polyclonal Antibody to Granzyme A (GZMA)
MBS2139511-04 1 mL

Polyclonal Antibody to Granzyme A (GZMA)

Sign In for Pricing
View Details