Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKK6, Human (S207D, T211D, sf9, His)

The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (S207D, T211D, sf9, His) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MKK6 Protein, Human (S207D, T211D, sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mkk6-protein-human-s207d-t211d-sf9-his.html

Purity

94.00

Smiles

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDVAKDIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Molecular Formula

5608 (Gene_ID) P52564-1 (M1-D334, S207D, T211D) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CARHSP1 Antibody [DyLight 594]
NBP2-22260DL594 0.1 mL

Rabbit Polyclonal CARHSP1 Antibody [DyLight 594]

Sign In for Pricing
View Details
Trim44 (NM_001013203) Rat Tagged Lenti ORF Clone
RR202976L3 10 µg

Trim44 (NM_001013203) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Bestatin Methyl Ester 25mg
A13592-25 25 mg

Bestatin Methyl Ester 25mg

Sign In for Pricing
View Details
Human Bone Marrow Stromal Cell Antigen 1 ELISA Kit (BST1)
RK00993 96 Tests

Human Bone Marrow Stromal Cell Antigen 1 ELISA Kit (BST1)

Sign In for Pricing
View Details
Human FibuLin 1 (FBLN1) (NM_006487) AAV Particle
RC224482A1V 250 µL

Human FibuLin 1 (FBLN1) (NM_006487) AAV Particle

Sign In for Pricing
View Details
Anti-Mouse IgG (H+L) - 80nm Gold NanoUrchins
GUAC-80-02-10 0.5 mL

Anti-Mouse IgG (H+L) - 80nm Gold NanoUrchins

Sign In for Pricing
View Details