Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKK6, Human (S207D, T211D, sf9, His)

The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (S207D, T211D, sf9, His) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MKK6 Protein, Human (S207D, T211D, sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mkk6-protein-human-s207d-t211d-sf9-his.html

Purity

94.00

Smiles

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDVAKDIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Molecular Formula

5608 (Gene_ID) P52564-1 (M1-D334, S207D, T211D) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pig Pepsin A ELISA Kit
MBS2884706-01 48 Well

Pig Pepsin A ELISA Kit

Sign In for Pricing
View Details
Pig Pepsin A ELISA Kit
MBS2884706-02 96 Well

Pig Pepsin A ELISA Kit

Sign In for Pricing
View Details
Pig Pepsin A ELISA Kit
MBS2884706-03 5x 96 Well

Pig Pepsin A ELISA Kit

Sign In for Pricing
View Details
Pig Pepsin A ELISA Kit
MBS2884706-04 10x 96 Well

Pig Pepsin A ELISA Kit

Sign In for Pricing
View Details
Hoxb4 Mouse Gene Knockout Kit (CRISPR)
KN507892 1 Kit

Hoxb4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD85e/LILRA3 Protein (N-His, Human)
P502282 100 µg

CD85e/LILRA3 Protein (N-His, Human)

Sign In for Pricing
View Details