Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKK6, Human (S207D, T211D, sf9, His)

The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (S207D, T211D, sf9, His) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MKK6 Protein, Human (S207D, T211D, sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mkk6-protein-human-s207d-t211d-sf9-his.html

Purity

94.00

Smiles

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDVAKDIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Molecular Formula

5608 (Gene_ID) P52564-1 (M1-D334, S207D, T211D) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serpina5 ORF Vector (Mouse) (pORF)
43460014 1.0 µg DNA

Serpina5 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Ribokinase (RBKS, RBSK)
132381 100 µg

Ribokinase (RBKS, RBSK)

Sign In for Pricing
View Details
Slc25a47 (NM_001001509) Rat Tagged Lenti ORF Clone
RR209984L3 10 µg

Slc25a47 (NM_001001509) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal Spt6 Antibody [Biotin]
NB100-2584B 0.1 mL

Rabbit Polyclonal Spt6 Antibody [Biotin]

Sign In for Pricing
View Details
Mouse Dna2 Pre-designed siRNA Set B
SI103727B 1 Each

Mouse Dna2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
MMP-1 (3B6) Alexa Fluor® 790
sc-21731 AF790 200 µg/mL

MMP-1 (3B6) Alexa Fluor® 790

Sign In for Pricing
View Details