MKK6, Human (S207D, T211D, sf9, His)
The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (S207D, T211D, sf9, His) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells, with N-6*His labeled tag.
Product Specifications
Product Name Alternative
MKK6 Protein, Human (S207D, T211D, sf9, His), Human, Sf9 insect cells
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mkk6-protein-human-s207d-t211d-sf9-his.html
Purity
94.00
Smiles
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDVAKDIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
Molecular Formula
5608 (Gene_ID) P52564-1 (M1-D334, S207D, T211D) (Accession)
Molecular Weight
Approximately 40 kDa
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal TR4/NR2C2 Antibody (OTI4B1) [Alexa Fluor 594]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
NBP2-74577AF594 0.1 mL
Mouse Monoclonal TR4/NR2C2 Antibody (OTI4B1) [Alexa Fluor 594]
Sign In for Pricing
View Details MBS1415709-01 0.02 mg (E-Coli)
Recombinant Pig Succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial (OXCT1)
Sign In for Pricing
View Details 
MBS1415709-02 0.02 mg (Yeast)
Recombinant Pig Succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial (OXCT1)
Sign In for Pricing
View Details 
MBS1415709-03 0.1 mg (E-Coli)
Recombinant Pig Succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial (OXCT1)
Sign In for Pricing
View Details