Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKK6, Human (S207D, T211D, sf9, His)

The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (S207D, T211D, sf9, His) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MKK6 Protein, Human (S207D, T211D, sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mkk6-protein-human-s207d-t211d-sf9-his.html

Purity

94.00

Smiles

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDVAKDIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Molecular Formula

5608 (Gene_ID) P52564-1 (M1-D334, S207D, T211D) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TMED1 Rabbit pAb
GB114146-50 50 μL

Anti-TMED1 Rabbit pAb

Sign In for Pricing
View Details
Human MUC22 knockdown cell line
ABC-KD9671 1 Vial

Human MUC22 knockdown cell line

Sign In for Pricing
View Details
Anti-SNAI1 antibody
STJ27533 100 µl

Anti-SNAI1 antibody

Sign In for Pricing
View Details
Olfr843 Recombinant Protein (Mouse)
RP158888 100 µg

Olfr843 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
SIX6, ID (SIX6, OPTX2, SIX9, Homeobox protein SIX6, Homeodomain protein OPTX2, Optic homeobox 2, Sine oculis homeobox homolog 6) (Azide free) (HRP) discontinued
041768-HRP 200 µL

SIX6, ID (SIX6, OPTX2, SIX9, Homeobox protein SIX6, Homeodomain protein OPTX2, Optic homeobox 2, Sine oculis homeobox homolog 6) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Tissue Genomic DNA, Lung
CD564929 5 µg

Tissue Genomic DNA, Lung

Sign In for Pricing
View Details