Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKK6, Human (S207D, T211D, sf9, His)

The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (S207D, T211D, sf9, His) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MKK6 Protein, Human (S207D, T211D, sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mkk6-protein-human-s207d-t211d-sf9-his.html

Purity

94.00

Smiles

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDVAKDIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Molecular Formula

5608 (Gene_ID) P52564-1 (M1-D334, S207D, T211D) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSAD1 siRNA Oligos set (Human)
42765171 3x 5 nmol

RSAD1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
HSPC142 (BABAM1) Human shRNA Plasmid Kit (Locus ID 29086)
TL315663 1 Kit

HSPC142 (BABAM1) Human shRNA Plasmid Kit (Locus ID 29086)

Sign In for Pricing
View Details
Dibromoacetic Acid
TRC-D418730-100MG 100 mg

Dibromoacetic Acid

Sign In for Pricing
View Details
IGHV3-41 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV764209 1.0 µg DNA

IGHV3-41 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Rad52 Mouse siRNA Oligo Duplex (Locus ID 19365)
SR414145 1 Kit

Rad52 Mouse siRNA Oligo Duplex (Locus ID 19365)

Sign In for Pricing
View Details
Asb1 (NM_001108232) Rat Tagged Lenti ORF Clone
RR215556L3 10 µg

Asb1 (NM_001108232) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details