Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKK6, Human (S207D, T211D, sf9, His)

The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (S207D, T211D, sf9, His) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MKK6 Protein, Human (S207D, T211D, sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mkk6-protein-human-s207d-t211d-sf9-his.html

Purity

94.00

Smiles

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDVAKDIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Molecular Formula

5608 (Gene_ID) P52564-1 (M1-D334, S207D, T211D) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fdx1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6912008 1.0 µg DNA

Fdx1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Nfkbie 3'UTR Luciferase Stable Cell Line
TU114046 1.0 mL

Nfkbie 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) KSL4 Polyclonal Antibody
MBS7188747 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) KSL4 Polyclonal Antibody

Sign In for Pricing
View Details
Iyd sgRNA CRISPR Lentivector (Rat) (Target 1)
K7359702 1.0 µg DNA

Iyd sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
AJUBA (NM_032876) Human Tagged ORF Clone
RC205482 10 µg

AJUBA (NM_032876) Human Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral human AGAP4 shRNA (UAS) - Lentiviral human AGAP4 shRNA (UAS, iRFP) (100)
GTR15348174 1 Vial

Lentiviral human AGAP4 shRNA (UAS) - Lentiviral human AGAP4 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details