Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKK6, Human (S207D, T211D, sf9, His)

The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (S207D, T211D, sf9, His) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MKK6 Protein, Human (S207D, T211D, sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mkk6-protein-human-s207d-t211d-sf9-his.html

Purity

94.00

Smiles

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDVAKDIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Molecular Formula

5608 (Gene_ID) P52564-1 (M1-D334, S207D, T211D) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Exoc3l2 Pre-designed siRNA Set B
SI204652B 1 Each

Rat Exoc3l2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Notch3, CT (Notch homolog 3, Drosophila, hN3, CASIL, CADASIL) (Biotin) discontinued
031162-Biotin 200 µL

Notch3, CT (Notch homolog 3, Drosophila, hN3, CASIL, CADASIL) (Biotin) discontinued

Sign In for Pricing
View Details
ZBTB26 (NM_020924) Human 3' UTR Clone
SC207181 10 µg

ZBTB26 (NM_020924) Human 3' UTR Clone

Sign In for Pricing
View Details
Labsit 3 Leather w Ring Ornge
FUR3520 1 Each

Labsit 3 Leather w Ring Ornge

Sign In for Pricing
View Details
Rabbit Polyclonal PIGP Antibody [Alexa Fluor 350]
NBP3-06346AF350 0.1 mL

Rabbit Polyclonal PIGP Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Cttnbp2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3167307 1.0 µg DNA

Cttnbp2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details