Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKK6, Human (S207D, T211D, sf9, His)

The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (S207D, T211D, sf9, His) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MKK6 Protein, Human (S207D, T211D, sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mkk6-protein-human-s207d-t211d-sf9-his.html

Purity

94.00

Smiles

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDVAKDIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Molecular Formula

5608 (Gene_ID) P52564-1 (M1-D334, S207D, T211D) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR2T12 Rabbit Polyclonal Antibody
TA337497 100 µL

OR2T12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SPATA13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
45213111 3x 1.0 µg

SPATA13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Hydroxy-α-sanshool (Standard)
HY-N6825R 1 Each

Hydroxy-α-sanshool (Standard)

Sign In for Pricing
View Details
Osteomodulin Protein, Human, Recombinant (His Tag)
PH51278M2 50 µg

Osteomodulin Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
ADAMTS18 Polyclonal Antibody
RD77674A-01 20 µL

ADAMTS18 Polyclonal Antibody

Sign In for Pricing
View Details
ADAMTS18 Polyclonal Antibody
RD77674A-02 60 μL

ADAMTS18 Polyclonal Antibody

Sign In for Pricing
View Details