MKK6, Human (S207D, T211D, sf9, His)
The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (S207D, T211D, sf9, His) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells, with N-6*His labeled tag.
Product Specifications
Product Name Alternative
MKK6 Protein, Human (S207D, T211D, sf9, His), Human, Sf9 insect cells
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mkk6-protein-human-s207d-t211d-sf9-his.html
Purity
94.00
Smiles
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDVAKDIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
Molecular Formula
5608 (Gene_ID) P52564-1 (M1-D334, S207D, T211D) (Accession)
Molecular Weight
Approximately 40 kDa
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15345585 1 Vial
Lentiviral human TAGLN3 shRNA (UAS) - Lentiviral human TAGLN3 shRNA (UAS) (100)
Sign In for Pricing
View Details 39481065 1.0 µg DNA
RGS3 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details MBS6480914-01 0.1 mL
HLA Class 1 Antigen B, NT (HLA Cass I Histocompatibility Antigen B-27 alpha Chain, HLA B Class I, HLA-B, HLAB, HLA-B27, HLA-B73, AS, MGC111087, MHC Class I Antigen B*27, SPDA1) (MaxLight 405)
Sign In for Pricing
View Details 
MBS6480914-02 5x 0.1 mL
HLA Class 1 Antigen B, NT (HLA Cass I Histocompatibility Antigen B-27 alpha Chain, HLA B Class I, HLA-B, HLAB, HLA-B27, HLA-B73, AS, MGC111087, MHC Class I Antigen B*27, SPDA1) (MaxLight 405)
Sign In for Pricing
View Details 
250337-AP 100 µL
PPARGC1A (Peroxisome Proliferator-Activated Receptor gamma, Coactivator 1 alpha, LEM6, PGC-1 (alpha), PGC-1v, PGC1, PGC1A, PPARGC1) (AP) discontinued
Sign In for Pricing
View Details