Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKK6, Human (S207D, T211D, sf9, His)

The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (S207D, T211D, sf9, His) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MKK6 Protein, Human (S207D, T211D, sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mkk6-protein-human-s207d-t211d-sf9-his.html

Purity

94.00

Smiles

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDVAKDIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Molecular Formula

5608 (Gene_ID) P52564-1 (M1-D334, S207D, T211D) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMD11 Polyclonal Antibody
BT-AP07459-01 20 µL

PSMD11 Polyclonal Antibody

Sign In for Pricing
View Details
PSMD11 Polyclonal Antibody
BT-AP07459-02 50 µL

PSMD11 Polyclonal Antibody

Sign In for Pricing
View Details
PSMD11 Polyclonal Antibody
BT-AP07459-03 100 µL

PSMD11 Polyclonal Antibody

Sign In for Pricing
View Details
Manba Mouse shRNA Lentiviral Particle (Locus ID 110173)
TL509007V 500 µL Each

Manba Mouse shRNA Lentiviral Particle (Locus ID 110173)

Sign In for Pricing
View Details
FRMD1 (NM_001122841) Human Tagged ORF Clone
RC225817 10 µg

FRMD1 (NM_001122841) Human Tagged ORF Clone

Sign In for Pricing
View Details
OR51J1 3'UTR Luciferase Stable Cell Line
TU017078 1.0 mL

OR51J1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details