Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKK6, Human (S207D, T211D, sf9, His)

The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (S207D, T211D, sf9, His) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MKK6 Protein, Human (S207D, T211D, sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mkk6-protein-human-s207d-t211d-sf9-his.html

Purity

94.00

Smiles

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDVAKDIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Molecular Formula

5608 (Gene_ID) P52564-1 (M1-D334, S207D, T211D) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Lactobacillus sakei subsp. sakei Undecaprenyl-diphosphatase (uppP), partial
MBS7078283 Inquire

Recombinant Lactobacillus sakei subsp. sakei Undecaprenyl-diphosphatase (uppP), partial

Sign In for Pricing
View Details
IGKV3-15 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1058608 1.0 µg DNA

IGKV3-15 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
LTA4H Protein Vector (Rat) (pPM-C-His)
PV280321 500 ng

LTA4H Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
PROX1 (Prox-1, Prospero Homeobox Protein 1)
207355 100 µg

PROX1 (Prox-1, Prospero Homeobox Protein 1)

Sign In for Pricing
View Details
Fxn sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3410504 1.0 µg DNA

Fxn sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
TMEM151B Recombinant Protein Antigen
NBP2-30694PEP 0.1 mL

TMEM151B Recombinant Protein Antigen

Sign In for Pricing
View Details