MKK6, Human (S207D, T211D, sf9, His)
The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (S207D, T211D, sf9, His) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells, with N-6*His labeled tag.
Product Specifications
Product Name Alternative
MKK6 Protein, Human (S207D, T211D, sf9, His), Human, Sf9 insect cells
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mkk6-protein-human-s207d-t211d-sf9-his.html
Purity
94.00
Smiles
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDVAKDIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
Molecular Formula
5608 (Gene_ID) P52564-1 (M1-D334, S207D, T211D) (Accession)
Molecular Weight
Approximately 40 kDa
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
TL704416V 500 µL Each
Rhbdl3 Rat shRNA Lentiviral Particle (Locus ID 287556)
Sign In for Pricing
View Details 
251246-ML750 100 µL
RPA4 (Replication Protein A4, 34kD, HSU24186, MGC120333, MGC120334) (MaxLight 750) discontinued
Sign In for Pricing
View Details 
MBS716783-01 0.1 mL
Rabbit anti-human 3-oxoacyl-ACP synthase, mitochondrial polyclonal Antibody
Sign In for Pricing
View Details MBS716783-02 5x 0.1 mL
Rabbit anti-human 3-oxoacyl-ACP synthase, mitochondrial polyclonal Antibody
Sign In for Pricing
View Details