Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKK6, Human (S207D, T211D, sf9, His)

The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (S207D, T211D, sf9, His) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MKK6 Protein, Human (S207D, T211D, sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mkk6-protein-human-s207d-t211d-sf9-his.html

Purity

94.00

Smiles

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDVAKDIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Molecular Formula

5608 (Gene_ID) P52564-1 (M1-D334, S207D, T211D) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myozenin 1 (MYOZ1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B5]
TA808908BM 100 µL

Myozenin 1 (MYOZ1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B5]

Sign In for Pricing
View Details
Rat Cd72 Pre-designed siRNA Set B
SI202335B 1 Each

Rat Cd72 Pre-designed siRNA Set B

Sign In for Pricing
View Details
CSE1L (CSE1 Chromosome Segregation 1-like (yeast), CAS, CSE1, MGC117283, MGC130036, MGC130037, XPO2) (Biotin)
244978-Biotin 100 µL

CSE1L (CSE1 Chromosome Segregation 1-like (yeast), CAS, CSE1, MGC117283, MGC130036, MGC130037, XPO2) (Biotin)

Sign In for Pricing
View Details
Rabbit Polyclonal CYB5D1 Antibody
NBP1-56361 100 µL

Rabbit Polyclonal CYB5D1 Antibody

Sign In for Pricing
View Details
ZNF19 Antibody (N-term) Blocking Peptide
MBS9222598-01 0.5 mg

ZNF19 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
ZNF19 Antibody (N-term) Blocking Peptide
MBS9222598-02 5x 0.5 mg

ZNF19 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details