Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKK6, Human (S207D, T211D, sf9, His)

The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (S207D, T211D, sf9, His) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MKK6 Protein, Human (S207D, T211D, sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mkk6-protein-human-s207d-t211d-sf9-his.html

Purity

94.00

Smiles

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDVAKDIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Molecular Formula

5608 (Gene_ID) P52564-1 (M1-D334, S207D, T211D) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr94 ORF Vector (Mouse) (pORF)
ORF053041 1.0 µg DNA

Olfr94 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
PDIA4 (ERP70, ERP72, Protein Disulfide-isomerase A4, Endoplasmic Reticulum Resident Protein 70, Endoplasmic Reticulum Resident Protein 72) APC
MBS6138160-01 0.1 mL

PDIA4 (ERP70, ERP72, Protein Disulfide-isomerase A4, Endoplasmic Reticulum Resident Protein 70, Endoplasmic Reticulum Resident Protein 72) APC

Sign In for Pricing
View Details
PDIA4 (ERP70, ERP72, Protein Disulfide-isomerase A4, Endoplasmic Reticulum Resident Protein 70, Endoplasmic Reticulum Resident Protein 72) APC
MBS6138160-02 5x 0.1 mL

PDIA4 (ERP70, ERP72, Protein Disulfide-isomerase A4, Endoplasmic Reticulum Resident Protein 70, Endoplasmic Reticulum Resident Protein 72) APC

Sign In for Pricing
View Details
Dab1 (Phospho Tyr220) Antibody
A9546-01 50 μL

Dab1 (Phospho Tyr220) Antibody

Sign In for Pricing
View Details
Dab1 (Phospho Tyr220) Antibody
A9546-02 100 µL

Dab1 (Phospho Tyr220) Antibody

Sign In for Pricing
View Details
Goat Exportin 7 (XPO7) ELISA Kit
MBS9360928 Inquire

Goat Exportin 7 (XPO7) ELISA Kit

Sign In for Pricing
View Details