Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKK6, Human (S207D, T211D, sf9, His)

The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (S207D, T211D, sf9, His) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MKK6 Protein, Human (S207D, T211D, sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mkk6-protein-human-s207d-t211d-sf9-his.html

Purity

94.00

Smiles

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDVAKDIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Molecular Formula

5608 (Gene_ID) P52564-1 (M1-D334, S207D, T211D) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WBSCR11 Polyclonal Antibody
MBS2539472-01 0.02 mL

WBSCR11 Polyclonal Antibody

Sign In for Pricing
View Details
WBSCR11 Polyclonal Antibody
MBS2539472-02 0.06 mL

WBSCR11 Polyclonal Antibody

Sign In for Pricing
View Details
WBSCR11 Polyclonal Antibody
MBS2539472-03 0.12 mL

WBSCR11 Polyclonal Antibody

Sign In for Pricing
View Details
WBSCR11 Polyclonal Antibody
MBS2539472-04 0.2 mL

WBSCR11 Polyclonal Antibody

Sign In for Pricing
View Details
HLA Class II Histocompatibility Antigen Gamma Chain (CD74) Antibody (ATTO488)
abx440382 100 µg

HLA Class II Histocompatibility Antigen Gamma Chain (CD74) Antibody (ATTO488)

Sign In for Pricing
View Details
ARH 77
ABC-TC0047 1 Vial

ARH 77

Sign In for Pricing
View Details