Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKK6, Human (S207D, T211D, sf9, His)

The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (S207D, T211D, sf9, His) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MKK6 Protein, Human (S207D, T211D, sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mkk6-protein-human-s207d-t211d-sf9-his.html

Purity

94.00

Smiles

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDVAKDIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Molecular Formula

5608 (Gene_ID) P52564-1 (M1-D334, S207D, T211D) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spatc1 (NM_001115026) Rat Tagged ORF Clone
RR205996 10 µg

Spatc1 (NM_001115026) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Canine Gelsolin (GS) ELISA Kit
NSL0380Ca 96 Tests

Canine Gelsolin (GS) ELISA Kit

Sign In for Pricing
View Details
Bovine anti-adrenocortical antibody (AAA) ELISA Kit
EIA05181Bo 1 Kit

Bovine anti-adrenocortical antibody (AAA) ELISA Kit

Sign In for Pricing
View Details
Abcc9 3'UTR GFP Stable Cell Line
TU151163 1.0 mL

Abcc9 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit Polyclonal TMEM103 Antibody [mFluor Violet 450 SE]
NBP2-98169MFV450 0.1 mL

Rabbit Polyclonal TMEM103 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Metoxibutropate
MBS5782910 Inquire

Metoxibutropate

Sign In for Pricing
View Details