Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKK6, Human (S207D, T211D, sf9, His)

The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (S207D, T211D, sf9, His) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MKK6 Protein, Human (S207D, T211D, sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mkk6-protein-human-s207d-t211d-sf9-his.html

Purity

94.00

Smiles

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDVAKDIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Molecular Formula

5608 (Gene_ID) P52564-1 (M1-D334, S207D, T211D) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tnnc1 (NM_009393) AAV Particle
MR201266A1V 250 µL

Mouse Tnnc1 (NM_009393) AAV Particle

Sign In for Pricing
View Details
PMVK Polyclonal Antibody, Cy5.5 Conjugated
bs-5371R-Cy5.5 100 µL

PMVK Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Cysteine-Rich Protein 1 Protein
abx261117-01 5 µg

Cysteine-Rich Protein 1 Protein

Sign In for Pricing
View Details
Cysteine-Rich Protein 1 Protein
abx261117-02 20 µg

Cysteine-Rich Protein 1 Protein

Sign In for Pricing
View Details
Cysteine-Rich Protein 1 Protein
abx261117-03 1 mg

Cysteine-Rich Protein 1 Protein

Sign In for Pricing
View Details
Armc9 (NM_001109663) Rat Tagged Lenti ORF Clone
RR209463L3 10 µg

Armc9 (NM_001109663) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details