Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-synuclein (SNCB)

Product Specifications

Abbreviation

Recombinant Human SNCB protein

Gene Name

SNCB

UniProt

Q16143

Expression Region

1-134aa

Organism

Homo sapiens (Human)

Target Sequence

MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Non-amyloid component of senile plaques found in Alzheimer disease. Could act as a regulator of SNCA aggregation process. Protects neurons from staurosporine and 6-hydroxy dopamine (6OHDA) -stimulated caspase activation in a p53/TP53-dependent manner. Contributes to restore the SNCA anti-apoptotic function abolished by 6OHDA. Not found in the Lewy bodies associated with Parkinson disease.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.7 kDa

References & Citations

"Synucleins are a novel class of substrates for G protein-coupled receptor kinases." Pronin A.N., Morris A.J., Surguchov A., Benovic J.L. J. Biol. Chem. 275:26515-26522 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,6-Dichlorotrimellitic acid
MBS5755761 Inquire

3,6-Dichlorotrimellitic acid

Sign In for Pricing
View Details
7-BIA 25mg
A18934-25 25 mg

7-BIA 25mg

Sign In for Pricing
View Details
TMEM126A Human siRNA Oligo Duplex (Locus ID 84233)
SR313414 1 Kit

TMEM126A Human siRNA Oligo Duplex (Locus ID 84233)

Sign In for Pricing
View Details
Recombinant Saccharomyces Cerevisiae KRE28 Protein (aa 1-385) [His] (strain JAY291)
VAng-Wyb4894-1mg 1 mg

Recombinant Saccharomyces Cerevisiae KRE28 Protein (aa 1-385) [His] (strain JAY291)

Sign In for Pricing
View Details
PTLEP-01-7593-YL AF Systems Consumables
802260 Roll of 250 Label(s)

PTLEP-01-7593-YL AF Systems Consumables

Sign In for Pricing
View Details
Recombinant Human DVL2 Protein, N-GST&C-His
orb3149392-01 50 µg

Recombinant Human DVL2 Protein, N-GST&C-His

Sign In for Pricing
View Details