Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAA1, Human (His)

SAA1 Protein, a major acute phase protein, forms a homohexamer comprising dimers of trimers. While the native form doesn't spontaneously form amyloid fibrils, partial proteolysis can induce amyloid fibril generation. SAA1 also serves as an apolipoprotein in the HDL complex and shows affinity for heparin. SAA1 Protein, Human (His) is the recombinant human-derived SAA1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

SAA1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/saa1-protein-human-his.html

Purity

97.21

Smiles

RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY

Molecular Formula

6288 (Gene_ID) AAH07022.1 (R19-Y122) (Accession)

Molecular Weight

Approximately 13.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RNPEPL1 activation kit by CRISPRa
GA111401 1 Kit

Human RNPEPL1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Leucine Rich Repeat Containing Protein 3C (LRRC3C) ELISA Kit
EKU05606 96 Tests

Human Leucine Rich Repeat Containing Protein 3C (LRRC3C) ELISA Kit

Sign In for Pricing
View Details
PTTG1IP AAV Vector (Human) (CMV)
38198101 1 µg

PTTG1IP AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Lentiviral human AMPH shRNA (UAS) - Lentiviral human AMPH shRNA (UAS, GFP) (25)
GTR15095540 1 Vial

Lentiviral human AMPH shRNA (UAS) - Lentiviral human AMPH shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
WNT5B 293 Cell Lysate
402767 0.1 mg

WNT5B 293 Cell Lysate

Sign In for Pricing
View Details
OAAV00159-200UG - CD8 Alpha/Lyt-2 Antibody
OAAV00159-200UG 200µg

OAAV00159-200UG - CD8 Alpha/Lyt-2 Antibody

Sign In for Pricing
View Details