Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPEP2 (Dipeptidase 2, DPEP2) (AP) discontinued
302394-AP 100 µL

DPEP2 (Dipeptidase 2, DPEP2) (AP) discontinued

Sign In for Pricing
View Details
DAPK1 (Death-associated Protein Kinase 1, DAP Kinase 1, DAPK) (MaxLight 650)
MBS6221747-01 0.1 mL

DAPK1 (Death-associated Protein Kinase 1, DAP Kinase 1, DAPK) (MaxLight 650)

Sign In for Pricing
View Details
DAPK1 (Death-associated Protein Kinase 1, DAP Kinase 1, DAPK) (MaxLight 650)
MBS6221747-02 5x 0.1 mL

DAPK1 (Death-associated Protein Kinase 1, DAP Kinase 1, DAPK) (MaxLight 650)

Sign In for Pricing
View Details
DDT Blocking Peptide
33R-7078 100 ug

DDT Blocking Peptide

Sign In for Pricing
View Details
SRT 1460 TFA Salt
TRC-S684450-1MG 1 mg

SRT 1460 TFA Salt

Sign In for Pricing
View Details
Recombinant Rat Lipase member H (Liph)
MBS1442186-01 0.02 mg (E-Coli)

Recombinant Rat Lipase member H (Liph)

Sign In for Pricing
View Details