Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLT1, Recombinant, Human (Fms-like tyrosine kinase 1, Tyrosine-protein kinase FRT, Tyrosine-protein kinase receptor FLT, Vascular permeability factor receptor) discontinued
169972 10 µg

FLT1, Recombinant, Human (Fms-like tyrosine kinase 1, Tyrosine-protein kinase FRT, Tyrosine-protein kinase receptor FLT, Vascular permeability factor receptor) discontinued

Sign In for Pricing
View Details
Tas1r1 (NM_031867) Mouse Tagged ORF Clone
MR223642 10 µg

Tas1r1 (NM_031867) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
3- (S) - (4- (S) -isopropyl-2-oxo-oxazolidine-3-carbonyl) -octanoic Acid tert-Butyl Ester
I9041-09 50 mg

3- (S) - (4- (S) -isopropyl-2-oxo-oxazolidine-3-carbonyl) -octanoic Acid tert-Butyl Ester

Sign In for Pricing
View Details
Human Pannexin-2 (PANX2) ELISA Kit
abx537740 96 Tests

Human Pannexin-2 (PANX2) ELISA Kit

Sign In for Pricing
View Details
EEA1 Immunizing Peptide
MBS428218-01 0.1 mg

EEA1 Immunizing Peptide

Sign In for Pricing
View Details
EEA1 Immunizing Peptide
MBS428218-02 5x 0.1 mg

EEA1 Immunizing Peptide

Sign In for Pricing
View Details